DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and cyp-37B1

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_507109.1 Gene:cyp-37B1 WormBaseID:WBGene00009226 Length:509 Species:Caenorhabditis elegans

Alignment Length:531 Identity:172/532 (32%)
Similarity:278/532 (52%) Gaps:54/532 (10%)


  Fly     2 WLTLITGALILL------LTWDFGRKRQRVLAFEKSAIPGPISIPILGC------------GLQA 48
            :|.:.|..||.:      |.::|.|.|.|:..:.:. ..||.|.||:|.            ..|:
 Worm     3 FLNIATIFLITIFLFYYKLIYNFIRDRLRIYKYMRK-FDGPYSFPIIGTLYMVNIFDISKFTTQS 66

  Fly    49 LHLG---AENIIGWVGEKFDKYGKTFRFWILGESLIYTKDLQYFETILSSTTLLEKGQLYEYLRP 110
            :.|.   .:...|.:|           .|:....||...:.|:.:.||.|..::.|.:.|:.|.|
 Worm    67 MELAQYYCQKGCGTIG-----------LWLGPVPLIAVINPQHAKEILESNEVITKAEEYDILFP 120

  Fly   111 FLNDGLLVSTGRKWHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTAVDMLKYVS 175
            :|..|||.|||.||..|||:.|.|||||||..::.:.|..:.|.::.::..||....||:..|:.
 Worm   121 WLGTGLLTSTGSKWRQRRKMLTPAFHFKVLNDFLSVHDYQAKVFLEQIKPYADSGKEVDLFPYIK 185

  Fly   176 LAALDVITEAAMGVQVNAQNDPDFPYIKALKSVVYIQPDRMFRFSRRYNWLFPLAAPLLHRQLLS 240
            ..|||||.:.:|||.::|||:.|..|:::::.:.....:.:.|...|...|:.|..|  ..:...
 Worm   186 RLALDVICDTSMGVTIDAQNNHDHQYVESVRLLSEYAFEWILRPWLRLKPLWYLTGP--GHEYDR 248

  Fly   241 DIRVMHDFTDKVISERRETVRRAKADGTYRPLSLGDAEIGSKSQMALLDILLQSSINNQPL-SDA 304
            .::::.|||..||.|:.|..::...|    |:...|     |..||.||:||:  :.|:.| ::.
 Worm   249 HLKIVTDFTKTVIKEKWEEFQKFHVD----PVVKTD-----KRSMAFLDLLLE--LRNEGLMNED 302

  Fly   305 DIREEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASAPVTQAQLQDLKYL 369
            |||||||||||||.||||:.:...|:.:|.:||.|:::.:|:..:.| .:....|...|:.:|||
 Worm   303 DIREEVDTFMFEGHDTTSASMGWTLWCLAHNPEFQEKVIQEVDGIFG-TSDRDCTNDDLKQMKYL 366

  Fly   370 DCVIKETMRLYPPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHRDANYFPDPLSFRPERFLE 434
            :..:||::|:||.||..||..::::.|.....|....|.::.....|:...|.:|..:.||.|.|
 Worm   367 EKCLKESLRMYPSVPFFGRTVEQDVVINGDFFPKGVRIIVMPLLLQRNPLIFDNPNQYNPENFSE 431

  Fly   435 DQEQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYELL---PLG-EELKPMLNFILRS 495
            |:....:.::.:||||||:||||||||::|.|.:||...|.|.:.   |.| .::.|.|  ||:|
 Worm   432 DKIGSRHAYSDIPFSAGPRNCIGQKFAMMEEKAVISWFFRKYRVTASQPFGMNKILPEL--ILKS 494

  Fly   496 ASGINVGLRPR 506
            :.|..:.:..|
 Worm   495 SLGFPLTVHHR 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 159/479 (33%)
cyp-37B1NP_507109.1 p450 41..475 CDD:278495 154/459 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 1 1.100 O PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.