DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and cyp-29A2

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_505847.1 Gene:cyp-29A2 WormBaseID:WBGene00011830 Length:503 Species:Caenorhabditis elegans

Alignment Length:515 Identity:171/516 (33%)
Similarity:265/516 (51%) Gaps:72/516 (14%)


  Fly    16 WDFGRKRQRVLAFEKSAIPGPISIPILGCGLQALHLG------AENI----IGWVGEKFDKYGKT 70
            |.:|.|           :|||.:.||.|      :||      .|::    |.|..|:.|:....
 Worm    30 WQYGSK-----------LPGPPAHPIFG------NLGPIVGKKTEDLPSVFINWAAEQRDQGHSV 77

  Fly    71 FRFWILGESLIYTKDLQYFETILSSTTLLEKGQLYEYLRPFLNDGLLV-STGRKWHARRKIFTHA 134
            .|..|||:...:..:.:....|:.|||...||..|.:..|:|..|||: ..|.:|.:.||:.|.|
 Worm    78 MRVMILGKVYAWPLNGKAAAAIIDSTTETNKGDDYRFFDPWLGGGLLLEGYGERWKSHRKMLTPA 142

  Fly   135 FHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTAVDMLKYVSLAALDVITEAAMGVQVNAQNDPDF 199
            |||..|..|.|:.:..|.:::|.|...:.....||:..||...|||:|:|.|||::::||.:.|.
 Worm   143 FHFAKLGGYFEVFNNESKILIDLLSDFSASGETVDIFPYVKRCALDIISETAMGIKIDAQINHDH 207

  Fly   200 PYIKALKSVVYIQPDRMFRFSRRYNWLFPLAA--PLLHRQLL---SDIRVMHD--------FTDK 251
            .|::|::.               ||.:..|.:  |.|..|.:   :..:..:|        .|:|
 Worm   208 KYVQAVEG---------------YNKIGVLVSFNPHLKNQFIFWATGYKAQYDDYLSTLKSMTEK 257

  Fly   252 VISERRETVRRAKADGTYRPLSLGDAE-IGSKSQMALLDILLQSSINNQPLSDADIREEVDTFMF 315
            ||.|     |||..|.       |:.| ..||..|..||::|....:|| |:..|||:|||||||
 Worm   258 VIKE-----RRAAHDS-------GEVEKETSKRMMNFLDLMLSMEESNQ-LTSEDIRQEVDTFMF 309

  Fly   316 EGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASAPVTQAQLQDLKYLDCVIKETMRLY 380
            .|.|||:|..|.|.:.:|.:|.||:::::|:..|.|.|.:..:|...:.:|.|||.|:||:.|:.
 Worm   310 AGHDTTTSSTSWACWNLAHNPNVQEKVYKEMIEVFGDDPNTDITLENVNNLNYLDIVLKESKRII 374

  Fly   381 PPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHRDANYFPDPLSFRPERFLEDQEQGHNTFAY 445
            .||||:.|....:|||....:||..::.:.....|.:.:.|.:|..|.|:|||.|:....:.:.:
 Worm   375 APVPALQRKLTNDLEIDGYIVPAGGNVTISPMVLHSNHHVFKNPTEFNPDRFLPDEVSKRHPYDF 439

  Fly   446 VPFSAGPKNCIGQKFAVLEMKVLISKVLRFYELLPL--GEELKPMLNFILRSASGINVGL 503
            :||.|||:||||||||.|..||:||.::|.:::.|.  ..:.||.|..:.:.::||.|.|
 Worm   440 MPFLAGPRNCIGQKFAQLNEKVMISHIVRNFKIEPTLKYNDTKPCLEVVTKPSNGIPVRL 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 164/486 (34%)
cyp-29A2NP_505847.1 p450 37..495 CDD:278495 165/492 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 1 1.100 O PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.