DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and cyp-32A1

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_505009.4 Gene:cyp-32A1 WormBaseID:WBGene00016147 Length:529 Species:Caenorhabditis elegans

Alignment Length:548 Identity:177/549 (32%)
Similarity:277/549 (50%) Gaps:71/549 (13%)


  Fly     3 LTLITGALILLLT---------WDFGRKRQRVLAFEKSAIPGPISIPILGCGLQALHLGAEN--- 55
            ::::.|.:|.|:.         |...||    .|...|.:.||.::|::|    :.||...|   
 Worm     5 ISIVIGYVIYLVVVNFQQILELWRINRK----CAQNLSMVNGPPALPLVG----SAHLFKWNPYA 61

  Fly    56 ----IIGWVGEKF----DKYGK----------TFRFWILGESLIYTKDLQYFETILSSTTLLEKG 102
                :.|| .:|:    .|||:          ....||....:::....:....:|.|.|.:.|.
 Worm    62 FTFQMEGW-AQKYLFGRAKYGEIAAPNNEVDGIMLLWIGPVPIVFLGTSECIRPVLESNTNISKP 125

  Fly   103 QLYEYLRPFLNDGLLVSTGRKWHARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTA 167
            ..|:.:..::..|||.||..||..|||:.|..|||.:::.|..:..|::.|:.|.:....|| ..
 Worm   126 SQYDKMSEWIGTGLLTSTHEKWFHRRKMLTPTFHFTIIQDYFPVFVRNAEVLADAVELHVDG-DY 189

  Fly   168 VDMLKYVSLAALDVITEAAMGVQVNAQNDPDFPYIKALKSVVYIQPDRMFRFSRRYNWLFPLAAP 232
            .|...|.....||:|.|.|||:|||||...:..|:.|:|.:..|..:.|     ::.||:  ..|
 Worm   190 FDAFPYFKRCTLDIICETAMGIQVNAQLGHNNEYVHAVKRISEIVWNHM-----KFPWLW--LKP 247

  Fly   233 LLHRQLLS-----DIRVMHDFTDKVISERRETVRRAKADGTYRPLSLGDAEIGSKSQMALLDILL 292
            :.:...|.     ::|:.::|..|||.||:|.:..   ||.         |...|.:.|.||:||
 Worm   248 IWYLTGLGFEFDRNVRMTNNFVRKVIQERKELLNE---DGN---------EASEKKRKAFLDLLL 300

  Fly   293 QSSINNQPLSDADIREEVDTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQRVLGPDASAP 357
            ........|||.|||||||||||||.||||||:...:..:..:||.|:::.:||..|.|.:.:.|
 Worm   301 TIQKEEGTLSDEDIREEVDTFMFEGHDTTSSGIGFTILWLGFYPECQKKLQKELDEVFGFETNQP 365

  Fly   358 VTQAQLQDLKYLDCVIKETMRLYPPVPAIGRHAQKELEI----GDK-TIPANTSIYLVLYYAHRD 417
            .:...::...||:..|||::|::|.||.|.|...:::.|    |.| .:||..:..:....|.||
 Worm   366 PSMDDIKKCSYLEKCIKESLRMFPSVPLIARRLSEDVTINHPSGQKIVLPAGLAACVSPIAAARD 430

  Fly   418 ANYFPDPLSFRPERFLEDQEQGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLRFYEL--LP 480
            ...:|||.::.|:.|..|...|.:.:||:||||||:||||||||:||.|.::|...|.||:  |.
 Worm   431 PRAWPDPDTYNPDNFDIDAIAGRDPYAYIPFSAGPRNCIGQKFALLEQKTILSTFFRKYEVESLQ 495

  Fly   481 LGEELKPMLNFILRSASGINVGLRPRKA 508
            ..|.|:|:...|||..:|:.:.::.|:|
 Worm   496 TEENLRPVPELILRPYNGMKIKIKRREA 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 164/492 (33%)
cyp-32A1NP_505009.4 p450 42..510 CDD:278495 166/493 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 1 1.100 O PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.