DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and cyp-37A1

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_496939.2 Gene:cyp-37A1 WormBaseID:WBGene00008499 Length:508 Species:Caenorhabditis elegans

Alignment Length:506 Identity:170/507 (34%)
Similarity:260/507 (51%) Gaps:57/507 (11%)


  Fly    18 FGRKRQRVLAFEKSAIPGPISIPILGCGLQ--------ALHLGAENIIGWVGEKFDKYGKTFRFW 74
            |.::|.| |....|.|.||:::|:||...|        ||.|     ..|..|...|......||
 Worm    25 FVKERMR-LYHLMSKIDGPLALPLLGTTFQFKMDPVEFALQL-----YNWGLEYSTKGSSLAAFW 83

  Fly    75 ILGESLIYTKDLQYFETILSSTTLLEKGQLYEYLRPFLNDGLLVSTGRKWHARRKIFTHAFHFKV 139
            :....::.....:..:.:|.|..|:.|...|:...|:|..|||:::|.||..|||:.|.:|||.|
 Worm    84 MGPYPMVIVLTPEANKKVLESNALINKSSEYDIFLPWLGTGLLLASGEKWRGRRKMMTPSFHFNV 148

  Fly   140 LEHYVEIMDRHSSVM---VDNLRKVADGKTAVDMLKYVSLAALDVITEAAMGVQVNAQNDPDFPY 201
            |..:..:.:..|.::   ::|..|..|..| :|...|:...|||:|.|.|||..|:||.:...||
 Worm   149 LIDFQVVFNSQSMILLEQIENAAKKTDDST-IDAFPYIKRCALDIICETAMGTTVSAQTNHTHPY 212

  Fly   202 IKALKSVVYIQPDRMFRFSRR-YNWLFPLAAPLLHRQLLS-------DIRVMHDFTDKVISERRE 258
            :.|:..:..:    .|::.|. :.|:.|:      |||:.       ::.::..||.|||.  |:
 Worm   213 VVAVNEMNSL----AFKYQRMPWLWIKPI------RQLIGYEADFQRNLDIVTSFTKKVID--RK 265

  Fly   259 TVRRAKADGTYRPLSLGDAEIGSKSQMALLDILLQSSINNQPLSDADIREEVDTFMFEGDDTTSS 323
            .....:.||      :...|..||.: |.||:|::.. ....|...|||||||||||||.||||:
 Worm   266 LREHDETDG------MVVVEEESKKK-AFLDMLIEKK-EEGGLGYEDIREEVDTFMFEGHDTTSA 322

  Fly   324 GVSHALYAIARHPEVQQRIFEELQRVLGPDASAPVTQAQLQDLKYLDCVIKETMRLYPPVPAIGR 388
            |:..:|:.:|..||.|::..|||..:. ...|...:...|:.:|||:..:||.:|:.|.||.:.|
 Worm   323 GIGWSLWCLANCPEYQKKCHEELDEIF-EGTSRECSVEDLKKMKYLEKCVKEALRMRPSVPQMAR 386

  Fly   389 HAQKELEIGDKTIPANTSIYLVLYYAHRDANYFPDPLSFRPERFLEDQEQGHNTFAYVPFSAGPK 453
            ..::|:||..|.:|...|:.:...:...:...||:...|.||||.||:....:.:||:||||||:
 Worm   387 SVEEEVEIDGKILPKGCSVMISPAFIQNNPRTFPNHEVFDPERFNEDEISKRHAYAYIPFSAGPR 451

  Fly   454 NCIGQKFAVLEMKVLISKVLRFY---------ELLPLGEEL-KPMLNFILR 494
            ||||||||:.|.|.:||.|||.:         |.:||.|.: :|.|.|.|:
 Worm   452 NCIGQKFAMQEEKTVISWVLRRFHIHTDIGLLENMPLPETITRPSLGFPLK 502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 163/488 (33%)
cyp-37A1NP_496939.2 p450 41..503 CDD:278495 164/490 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.