DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp4d20 and Cyp26a1

Sequence 1:NP_647723.2 Gene:Cyp4d20 FlyBaseID:FBgn0035344 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_569092.2 Gene:Cyp26a1 RGDID:620161 Length:497 Species:Rattus norvegicus

Alignment Length:492 Identity:113/493 (23%)
Similarity:197/493 (40%) Gaps:63/493 (13%)


  Fly     5 LITGALILLL------TWDF----GRKRQRVLAFEKSAIPGPISIPILGCGLQALHLGAENIIGW 59
            |.|..|.|||      .||.    .|.|...|...    ||.:..|..|..||.:....:    :
  Rat    11 LCTFVLPLLLFLAALKLWDLYCVSSRDRSCALPLP----PGTMGFPFFGETLQMVLQRRK----F 67

  Fly    60 VGEKFDKYGKTFRFWILGESLIYTKDLQYFETILSSTTLLEKGQLYEYLRPFLNDGLLVSTGRKW 124
            :..|..|||..::..:.|...:..........||.....|........:|..|..|.|.:.....
  Rat    68 LQMKRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTILGAGCLSNLHDSS 132

  Fly   125 H-ARRKIFTHAFHFKVLEHYVEIMDRHSSVMVDNLRKVADGKTAVDMLKYVSLAALDVITEAAMG 188
            | .|:|:...||:.:.|:.||.::....|..::......:.    .:|.|..:..|  :...||.
  Rat   133 HKQRKKVIMQAFNREALQCYVPVIAEEVSGCLEQWLSCGER----GLLVYPEVKRL--MFRIAMR 191

  Fly   189 VQVNAQNDP------DFPYIKALKSVVYIQPDRMFRFSRRYNWLFPLAAPL--LHRQLLSDIRVM 245
            :.:..:..|      :...::|.:.:.            |..:..|:..|.  |:|.:.:     
  Rat   192 ILLGCEPGPAGGGEDEQQLVEAFEEMT------------RNLFSLPIDVPFSGLYRGVKA----- 239

  Fly   246 HDFTDKVISERRETVRRAKADGTYRPLSLGDAEIGSKSQMALLDILLQSSINNQPLSDADIREEV 310
                ..:|..|.|...|||    .|.|...:.:.|.|..:.||  :..|....:.|....:::..
  Rat   240 ----RNLIHARIEENIRAK----IRRLQAAEPDAGCKDALQLL--IEHSWERGERLDMQALKQSS 294

  Fly   311 DTFMFEGDDTTSSGVSHALYAIARHPEVQQRIFEELQR---VLGPDASAPVTQAQLQDLKYLDCV 372
            ...:|.|.:||:|..:..:..:..:|.|.|::.||::.   :........:....|:.|||:.||
  Rat   295 TELLFGGHETTASAATSLITYLGLYPHVLQKVREEIKSKGLLCKSHHEDKLDMETLEQLKYIGCV 359

  Fly   373 IKETMRLYPPVPAIGRHAQKELEIGDKTIPANTSIYLVLYYAHRDANYFPDPLSFRPERFLEDQE 437
            ||||:||.||||...|.|.|..|:....||...::...:...|..|:.|.:...|.|:||.....
  Rat   360 IKETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVADSFTNKEEFNPDRFTSLHP 424

  Fly   438 QGHNTFAYVPFSAGPKNCIGQKFAVLEMKVLISKVLR 474
            :..:.|:::||..|.::|:|::||.:.:|:...::.|
  Rat   425 EDTSRFSFIPFGGGLRSCVGKEFAKILLKIFTVELAR 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp4d20NP_647723.2 p450 34..493 CDD:278495 102/454 (22%)
Cyp26a1NP_569092.2 p450 43..491 CDD:299894 102/461 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.