DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16762 and CG10911

DIOPT Version :9

Sequence 1:NP_647722.1 Gene:CG16762 / 38310 FlyBaseID:FBgn0035343 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_611286.1 Gene:CG10911 / 37058 FlyBaseID:FBgn0034295 Length:359 Species:Drosophila melanogaster


Alignment Length:232 Identity:69/232 - (29%)
Similarity:116/232 - (50%) Gaps:14/232 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKILASLAMIGLLVLSPAEGISRPLPPYVGLPTQDGLTRLFLNSRVTQTDPFASVACFGGYIGES 72
            ||:.|.|..:||     ::.|:.| |..:..|.|: |.:..:.||....|...::.|...|:...
  Fly     3 VKLCAILLALGL-----SQAIAYP-PLQLSNPHQN-LVQFLIQSRDLGNDGGHTLECLDYYLPLL 60

  Fly    73 NLIAELYSANYTKCYNAAADSRKGIDADFLATRRTIRLSSERVCSELRACNELNTTLESFQCHAN 137
            |.:.|.|.|:...|...|:.....|:.:....|..|..|::..|..|.||:.....::.|||::.
  Fly    61 NDVVETYKADLNACLETASQEVSQINDNTKEERDAIDASAKSSCDALTACSTKEAAIDYFQCYSE 125

  Fly   138 VGSNNTVSTYSISGNASESASVLEERYRVVDLRHGQCCQRAERHYVESTARNYNYLQACLDGRAK 202
            .|||||.:.::||.||||..:.:||..|::.::...|..:.:|.|.||..:.|..|..|:.|   
  Fly   126 AGSNNTKTMFTISANASELLAAVEEEVRLIKVKEEVCTNKTQRAYGESYGQLYADLGDCIAG--- 187

  Fly   203 PKPMPKPTSTTST-STTTTTTTTTTEAPTEPPTTTEA 238
               .|.|:.:||| :::|.::|.:|.|.||..|.:.:
  Fly   188 ---APIPSESTSTQASSTDSSTDSTSASTESSTDSSS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16762NP_647722.1 DUF725 60..180 CDD:283039 34/119 (29%)
CG10911NP_611286.1 DUF725 48..168 CDD:283039 34/119 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444962
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006718
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.