DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1317 and AT5G62460

DIOPT Version :9

Sequence 1:NP_001163328.1 Gene:CG1317 / 38300 FlyBaseID:FBgn0035333 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_001330074.1 Gene:AT5G62460 / 836366 AraportID:AT5G62460 Length:320 Species:Arabidopsis thaliana


Alignment Length:275 Identity:65/275 - (23%)
Similarity:88/275 - (32%) Gaps:106/275 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDD----LSQGDICRVCRCEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHKEYCELCSYSFS 61
            :||    |.|...||:|: |....:.|..||.|:||:||.|:.|:..|........||:|..  |
plant    78 VDDEEEPLIQSVECRICQ-EEDSVKNLESPCSCSGSLKYAHRKCVQRWCNEKGDTTCEICHK--S 139

  Fly    62 FQPIY-APDMPRVLPIKDVLVGLMSAVLEGARCWLHYTLVGLAWFGVVPLSAYRTYRYLFRASSF 125
            :||.| ||..|   |..|.::.                 :|..|...|.|. ....|.|..|::.
plant   140 YQPGYTAPPPP---PADDTIID-----------------IGEDWGNGVHLD-LNDPRILAMAAAE 183

  Fly   126 DMILTLPFDIFSVENLASDAFRGCFVVTCTLLSFIGLVWLREQILHGGGPDWLERDDAPLQAAAA 190
            .......:|.::..|.:..||  |   ....|..:.|:.||.                     |.
plant   184 RHFFDADYDEYADSNSSGAAF--C---RSAALILMALLLLRH---------------------AL 222

  Fly   191 NPAPDPAAEAAPQPQDDNNNADDNEAPAPADNDGQDA---------------------------- 227
            |..              |||:||.|       |...|                            
plant   223 NLT--------------NNNSDDEE-------DDPSAFFFLFMLRAAGFLLPCYIMAWAISILQR 266

  Fly   228 --QAQDAAPAAAAPV 240
              |.|:||..|||.|
plant   267 RRQRQEAAALAAAEV 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1317NP_001163328.1 RINGv 9..56 CDD:128983 17/46 (37%)
DotA_TraY <737..913 CDD:275142
AT5G62460NP_001330074.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.