powered by:
Protein Alignment CG1317 and AT5G01070
DIOPT Version :9
| Sequence 1: | NP_001163328.1 |
Gene: | CG1317 / 38300 |
FlyBaseID: | FBgn0035333 |
Length: | 988 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001154689.1 |
Gene: | AT5G01070 / 831898 |
AraportID: | AT5G01070 |
Length: | 206 |
Species: | Arabidopsis thaliana |
| Alignment Length: | 67 |
Identity: | 16/67 - (23%) |
| Similarity: | 28/67 - (41%) |
Gaps: | 12/67 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 DDLSQGDI-------CRVCRCEAQPDR-----PLFYPCICTGSIKYIHQDCLMLWMRYSHKEYCE 54
:.::.|.| ||:|....:..| |:...|.|...:.|:|:.|...|.:....:.||
plant 63 ESVASGSIRGSPEKDCRICHLGLESSRHECGDPMVLGCSCKDDLGYVHKQCADTWFKIKGNKTCE 127
Fly 55 LC 56
:|
plant 128 IC 129
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5183 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.