DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1317 and PIT1

DIOPT Version :9

Sequence 1:NP_001163328.1 Gene:CG1317 / 38300 FlyBaseID:FBgn0035333 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_567222.1 Gene:PIT1 / 828146 AraportID:AT4G02075 Length:218 Species:Arabidopsis thaliana


Alignment Length:225 Identity:46/225 - (20%)
Similarity:80/225 - (35%) Gaps:51/225 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CRVCRCEAQPDRPLFY--PCICTGSIKYIHQDCLMLWMRYSHKEYCELCSYSFSFQPIYAPDMPR 72
            ||:|..|.:..   |:  ||.|:|::|:.|::|:..|........||:|      ..:|......
plant    20 CRICHEEEEES---FFEVPCACSGTVKFAHRNCIQRWCNEKGNTTCEIC------LQVYKDGYTA 75

  Fly    73 VLPIKDVLVGLMSAVLEGARCWLHYTLVGLAWFGVVPLSA-------------YRTYRYLFRASS 124
            ||....::...::..:.|.|......||.:|...:...::             :....:|....:
plant    76 VLKQSKLIEQEVTIRVNGRRRRRSRRLVSIAESDISQCNSVADRGASFCRSLTFTLSVFLLMKHT 140

  Fly   125 FDMIL---TLPFDIFSVENL-ASDAFRGCFVVTCTLLSFIGLVWLREQILHGGGPDWLERDDAPL 185
            ||:|.   ..||.:|:|..| |.......|::..|:.:....:..|.|.......|.|..||   
plant   141 FDVIYGTEEYPFSVFTVLTLKAIGILLPMFIIIRTISTIQKTLRRRHQYPESEEEDRLSSDD--- 202

  Fly   186 QAAAANPAPDPAAEAAPQPQDDNNNADDNE 215
                                ||:...:|.|
plant   203 --------------------DDDLEEEDEE 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1317NP_001163328.1 RINGv 9..56 CDD:128983 15/47 (32%)
DotA_TraY <737..913 CDD:275142
PIT1NP_567222.1 RING-CH finger (C4HC3-type) 20..65 CDD:319409 15/47 (32%)
RINGv 20..65 CDD:128983 15/47 (32%)
DUF3675 72..176 CDD:372103 18/103 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.