DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1317 and AT3G06710

DIOPT Version :9

Sequence 1:NP_001163328.1 Gene:CG1317 / 38300 FlyBaseID:FBgn0035333 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_187327.2 Gene:AT3G06710 / 819856 AraportID:AT3G06710 Length:245 Species:Arabidopsis thaliana


Alignment Length:187 Identity:36/187 - (19%)
Similarity:62/187 - (33%) Gaps:66/187 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   759 WVRVALQYALPVLTLLGIFVLVPL---------------------LIGLLIELAVVIPLRVPLR- 801
            :||:.:.:|:..:.......|.||                     |.|||....:|..:|:|:. 
plant     6 YVRMVVPWAMAFILNTYCLSLHPLGQEVVVGFKRDYGMSTKSACFLNGLLYNGHLVFFMRIPIHE 70

  Fly   802 ----KTPIHF-----------------LWE------DWALGVLYCKIAIALTMMGPDWHLKRALD 839
                :.|..|                 ||:      :|...:|.........::|...|...|:.
plant    71 PIIARHPAGFQADILIKNVLGDGFVLVLWKYNKIVCEWYYSLLQSFFGEPPRLVGVAVHELGAIG 135

  Fly   840 RA--YMDGLRDFD--------------LKFVMRDLAVPVVTTIGLALAIPYVMAHMM 880
            |.  ::|. :.||              |.|..|.:|:.:|...||....|.::.:||
plant   136 RLLFFLDN-KSFDALTISICVSFFFILLPFSFRWIAIAIVGGGGLFENSPVILGYMM 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1317NP_001163328.1 RINGv 9..56 CDD:128983
DotA_TraY <737..913 CDD:275142 36/187 (19%)
AT3G06710NP_187327.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003180
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.