DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG1317 and AT2G45530

DIOPT Version :9

Sequence 1:	NP_001163328.1	Gene:	CG1317 / 38300	FlyBaseID:	FBgn0035333	Length:	988	Species:	Drosophila melanogaster
Sequence 2:	NP_566045.1	Gene:	AT2G45530 / 819161	AraportID:	AT2G45530	Length:	240	Species:	Arabidopsis thaliana

Alignment Length:	52	Identity:	15/52 - (28%)
Similarity:	24/52 - (46%)	Gaps:	1/52 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly     5 SQGDICRVCRCEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHKEYCELC 56
            |..:.|||| .:.:.:..:...|.|.|.:...|:.|:..|.|......||:|
plant    69 SSHEQCRVC-LQDKEEVLIELGCQCRGGLAKAHRSCIDAWFRTKGSNQCEIC 119

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG1317	NP_001163328.1	RINGv	9..56	CDD:128983	13/46 (28%)
CG1317	NP_001163328.1	DotA_TraY	<737..913	CDD:275142
AT2G45530	NP_566045.1	RINGv	73..120	CDD:128983	14/48 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5183
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900