powered by:
Protein Alignment CG1317 and AT2G37950
DIOPT Version :9
| Sequence 1: | NP_001163328.1 |
Gene: | CG1317 / 38300 |
FlyBaseID: | FBgn0035333 |
Length: | 988 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_181331.1 |
Gene: | AT2G37950 / 818372 |
AraportID: | AT2G37950 |
Length: | 207 |
Species: | Arabidopsis thaliana |
| Alignment Length: | 49 |
Identity: | 12/49 - (24%) |
| Similarity: | 19/49 - (38%) |
Gaps: | 2/49 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 10 CRVCR--CEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHKEYCELC 56
||:|. .|......:...|.|...:...|:.|...|.:....:.||:|
plant 84 CRICHLGVETSGGGAIELGCSCKDDLAVAHRQCAETWFKIKGDKTCEIC 132
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG1317 | NP_001163328.1 |
RINGv |
9..56 |
CDD:128983 |
11/47 (23%) |
| DotA_TraY |
<737..913 |
CDD:275142 |
|
| AT2G37950 | NP_181331.1 |
RINGv |
83..133 |
CDD:128983 |
12/49 (24%) |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5183 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.