DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1317 and AT2G37950

DIOPT Version :10

Sequence 1:NP_647715.2 Gene:CG1317 / 38300 FlyBaseID:FBgn0035333 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_181331.1 Gene:AT2G37950 / 818372 AraportID:AT2G37950 Length:207 Species:Arabidopsis thaliana


Alignment Length:49 Identity:12/49 - (24%)
Similarity:19/49 - (38%) Gaps:2/49 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CRVCR--CEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHKEYCELC 56
            ||:|.  .|......:...|.|...:...|:.|...|.:....:.||:|
plant    84 CRICHLGVETSGGGAIELGCSCKDDLAVAHRQCAETWFKIKGDKTCEIC 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1317NP_647715.2 SSM4 9..>206 CDD:227510 12/49 (24%)
RING_CH-C4HC3_MARCH6 9..58 CDD:438362 12/49 (24%)
SSM4 <359..>554 CDD:227510
AT2G37950NP_181331.1 RINGv 83..133 CDD:128983 12/49 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.