DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1317 and Marchf9

DIOPT Version :9

Sequence 1:NP_001163328.1 Gene:CG1317 / 38300 FlyBaseID:FBgn0035333 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_001094071.1 Gene:Marchf9 / 679272 RGDID:1590688 Length:346 Species:Rattus norvegicus


Alignment Length:235 Identity:48/235 - (20%)
Similarity:84/235 - (35%) Gaps:85/235 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CRVCRCEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHKEYCELCSYSFSFQPIYAPDMPRVL 74
            ||:| .:......|..||.|.||::..||.||:.|:.......||||.:.:....|...:     
  Rat   110 CRIC-FQGPEQGELLSPCRCDGSVRCTHQPCLIRWISERGSWSCELCYFKYQVLAISTKN----- 168

  Fly    75 PIKDVLVGL-------MSAVLEGARCWLHYTLVGLAWFGVVPLSAYRTYRYLFRASSFDMILTLP 132
            |::...:.|       ::|::.|: .:|..::..|.|..:.|.:.::..         |::..:.
  Rat   169 PLQWQAISLTVIEKVQIAAIVLGS-LFLVASISWLIWSSLSPSAKWQRQ---------DLLFQIC 223

  Fly   133 FDIFSVENLASDAFRGCFVVTCTLLSFIGLV-------------W--LREQ--ILH--------- 171
            :.::           |...|.|     |||:             |  :.:|  :|:         
  Rat   224 YGMY-----------GFMDVVC-----IGLIVHEGSSVYRIFKRWQAVNQQWKVLNYDKTKDVGG 272

  Fly   172 --GGGPDWLERDDAPLQAAAANPAP-----DPAAEAAPQP 204
              |||             ||..|.|     .|.|.|..:|
  Rat   273 DAGGG-------------AAGKPGPRTSRTSPPAGAPSRP 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1317NP_001163328.1 RINGv 9..56 CDD:128983 16/45 (36%)
DotA_TraY <737..913 CDD:275142
Marchf9NP_001094071.1 RINGv 109..155 CDD:128983 16/45 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.