DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG1317 and MARCHF7

DIOPT Version :9

Sequence 1:	NP_001163328.1	Gene:	CG1317 / 38300	FlyBaseID:	FBgn0035333	Length:	988	Species:	Drosophila melanogaster
Sequence 2:	NP_001269734.1	Gene:	MARCHF7 / 64844	HGNCID:	17393	Length:	704	Species:	Homo sapiens

Alignment Length:	60	Identity:	23/60 - (38%)
Similarity:	33/60 - (55%)	Gaps:	9/60 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly     6 QGDICRVCR-CEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHKE--------YCELC 56
            :||:||:|: ..|.....|..||.||||::|:||||:..|::.....        .||||
Human   548 EGDLCRICQMAAASSSNLLIEPCKCTGSLQYVHQDCMKKWLQAKINSGSSLEAVTTCELC 607

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG1317	NP_001163328.1	RINGv	9..56	CDD:128983	19/55 (35%)
CG1317	NP_001163328.1	DotA_TraY	<737..913	CDD:275142
MARCHF7	NP_001269734.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..126
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	157..279
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	294..313
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	319..343
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	361..425
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	444..473
		RING_Ubox	552..610	CDD:388418	21/56 (38%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	683..704
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5183
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R328
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.930