DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1317 and marc-1

DIOPT Version :10

Sequence 1:NP_647715.2 Gene:CG1317 / 38300 FlyBaseID:FBgn0035333 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_001122964.1 Gene:marc-1 / 6418739 WormBaseID:WBGene00077696 Length:206 Species:Caenorhabditis elegans


Alignment Length:103 Identity:32/103 - (31%)
Similarity:54/103 - (52%) Gaps:23/103 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ICRVCRCEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHKEYCELCSYSFS-----FQPIYAP 68
            |||:|:..   :..:..||.|.|::..:|::||..|:..|:|:.||:|...::     |:||...
 Worm    51 ICRICQMH---EGDMVRPCDCAGTMGDVHEECLTKWVNMSNKKTCEICKSEYTNSGAQFKPIKQW 112

  Fly    69 DMPR--------VLPIKDVLVGLMSA----VLEGARCW 94
            ..|:        ||.|  ||:||:.:    |:| .||:
 Worm   113 SKPKCSLNNIFHVLII--VLLGLLISYVVIVME-ERCF 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1317NP_647715.2 SSM4 9..>206 CDD:227510 32/103 (31%)
RING_CH-C4HC3_MARCH6 9..58 CDD:438362 17/48 (35%)
SSM4 <359..>554 CDD:227510
marc-1NP_001122964.1 RINGv 51..96 CDD:128983 16/47 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.