DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1317 and Marchf10

DIOPT Version :10

Sequence 1:NP_647715.2 Gene:CG1317 / 38300 FlyBaseID:FBgn0035333 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_766156.2 Gene:Marchf10 / 632687 MGIID:2443469 Length:788 Species:Mus musculus


Alignment Length:60 Identity:21/60 - (35%)
Similarity:34/60 - (56%) Gaps:9/60 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QGDICRVCR-CEAQPDRPLFYPCICTGSIKYIHQDCLMLWMR--------YSHKEYCELC 56
            :||:||:|: ....|..||..||.|.||::::||:||..|::        ....:.||:|
Mouse   635 EGDLCRICQIAGGSPANPLLEPCGCVGSLQFVHQECLKKWLKVKITSGADLGTVKTCEMC 694

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1317NP_647715.2 SSM4 9..>206 CDD:227510 19/57 (33%)
RING_CH-C4HC3_MARCH6 9..58 CDD:438362 19/57 (33%)
SSM4 <359..>554 CDD:227510
Marchf10NP_766156.2 RING_Ubox 629..705 CDD:473075 21/60 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.