DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1317 and marchf4

DIOPT Version :9

Sequence 1:NP_001163328.1 Gene:CG1317 / 38300 FlyBaseID:FBgn0035333 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_001025336.1 Gene:marchf4 / 562065 ZFINID:ZDB-GENE-041210-304 Length:378 Species:Danio rerio


Alignment Length:333 Identity:62/333 - (18%)
Similarity:115/333 - (34%) Gaps:115/333 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ICRVCRCEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHKEYCELCSYSFSFQPIYAPDMPRV 73
            :||:| .:......|..||.|:||::..||.||:.|:.......||||.|.:....|...:    
Zfish   107 VCRIC-FQGPEKGELLSPCRCSGSVRSTHQPCLIKWISERGSWTCELCYYKYQVIAISTKN---- 166

  Fly    74 LPIKDVLVGL-------MSAVLEGARCWLHYTLVGLAWFGVVPLSAYRTYRYLFRASSFDMILTL 131
             |::...:.|       ::|.:.|: .:|..::..|.|..:.|.:.::..         |::..:
Zfish   167 -PLQWQAISLTVIEKVQIAAAILGS-LFLIASISWLVWSSLSPSAKWQRQ---------DLLFQI 220

  Fly   132 PFDIFSVENLASDAFRGCFVVTCTLLSFIGLVWLREQILHGG-------------GPDWL----- 178
            .:.::           |...|.|..|           |:|.|             ...|.     
Zfish   221 CYGMY-----------GFMDVVCIAL-----------IVHEGPSVFRIFHRWQAVNQQWKVLNYD 263

  Fly   179 ERDDAPLQAAAANPAPDPAAEAAPQPQDDNNNADDNEAPAPADNDGQDAQAQDAAPAAAAPVVDA 243
            ::.|:..|.::     :...:...|.::   |...|.:|:          ......|||:||::.
Zfish   264 KKRDSEQQKSS-----EEQTQTLVQQRE---NTGSNISPS----------LSSILAAAASPVLEN 310

  Fly   244 DADEQNWNPMEWDRAAEELTWERLLGLDGSLVFLEHVFWIISLNTMFIFTFAFCPYCVGNFILSS 308
            .||.|       |...|      .:..||:.:..:|                 |||    .:|..
Zfish   311 TADSQ-------DSTGE------YMDADGTTLPDQH-----------------CPY----NLLQL 341

  Fly   309 MDLLQPEK 316
            :..|:|.:
Zfish   342 LSHLRPHE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1317NP_001163328.1 RINGv 9..56 CDD:128983 16/46 (35%)
DotA_TraY <737..913 CDD:275142
marchf4NP_001025336.1 RINGv 107..153 CDD:128983 16/46 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.