DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1317 and march2

DIOPT Version :9

Sequence 1:NP_001163328.1 Gene:CG1317 / 38300 FlyBaseID:FBgn0035333 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_001038255.2 Gene:march2 / 555611 ZFINID:ZDB-GENE-050208-777 Length:249 Species:Danio rerio


Alignment Length:154 Identity:41/154 - (26%)
Similarity:65/154 - (42%) Gaps:48/154 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SQGD--ICRVCR-----CEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHKEYCELCSYSFSF 62
            :|.|  .||:|.     |.::   .|..||.|||::..:|:.||..|:..|:..|||||...|:.
Zfish    57 TQSDRPTCRICHEGQDVCNSE---GLLSPCDCTGTLGTVHKSCLEKWLSSSNTSYCELCHTEFTI 118

  Fly    63 QPIYAPDMPRVLP--IKD-----------------VLVGLMSAV-----LEGARCWLHYT----L 99
            :     ..||.|.  ::|                 :.:..::|:     |.||:..||:.    .
Zfish   119 E-----RRPRPLTEWLRDPGPRNEKRTLFCDMVCFLFITPLAAISGWLCLRGAQDHLHFNSRLEA 178

  Fly   100 VGL-----AWFGVVPLSAYRTYRY 118
            |||     |.|.:..|....::||
Zfish   179 VGLIALTIALFTIYVLWTLVSFRY 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1317NP_001163328.1 RINGv 9..56 CDD:128983 18/51 (35%)
DotA_TraY <737..913 CDD:275142
march2NP_001038255.2 RINGv 64..113 CDD:128983 19/51 (37%)
Vpu 176..>220 CDD:109608 8/27 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.