powered by:
Protein Alignment CG1317 and MARCHF1
DIOPT Version :9
| Sequence 1: | NP_001163328.1 |
Gene: | CG1317 / 38300 |
FlyBaseID: | FBgn0035333 |
Length: | 988 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001381888.1 |
Gene: | MARCHF1 / 55016 |
HGNCID: | 26077 |
Length: | 545 |
Species: | Homo sapiens |
| Alignment Length: | 68 |
Identity: | 28/68 - (41%) |
| Similarity: | 40/68 - (58%) |
Gaps: | 1/68 - (1%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 DDLSQG-DICRVCRCEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHKEYCELCSYSFSFQPI 65
||.|.. ::||:|.||...:.||..||.|||:::::||.||..|::.|....||||.|.|..:..
Human 327 DDGSDNLEVCRICHCEGDEESPLITPCRCTGTLRFVHQSCLHQWIKSSDTRCCELCKYDFIMETK 391
Fly 66 YAP 68
..|
Human 392 LKP 394
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG1317 | NP_001163328.1 |
RINGv |
9..56 |
CDD:128983 |
20/46 (43%) |
| DotA_TraY |
<737..913 |
CDD:275142 |
|
| MARCHF1 | NP_001381888.1 |
None |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5183 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R328 |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.930 |
|
Return to query results.
Submit another query.