DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1317 and CG4080

DIOPT Version :9

Sequence 1:NP_001163328.1 Gene:CG1317 / 38300 FlyBaseID:FBgn0035333 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_001246695.1 Gene:CG4080 / 39079 FlyBaseID:FBgn0035983 Length:617 Species:Drosophila melanogaster


Alignment Length:264 Identity:70/264 - (26%)
Similarity:99/264 - (37%) Gaps:78/264 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SQGDICRVCRCEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHKEYCELCSYSFSFQPIYAPD 69
            :.|||||:|.||:.|..||..||.|:||:||:||.||..|:..|....||||.:.|...      
  Fly    38 NSGDICRICHCESDPQNPLLTPCYCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMH------ 96

  Fly    70 MPRVLPIKDVLVGLMSAVLEGARCWLHYTLVGLAWFGVVPLSAYRTYRYLFR-ASSFDMILTLPF 133
             .::.|..:               |....:.|:.       .....|..||. |::..:|.:|  
  Fly    97 -TKIKPFNE---------------WRSLDISGIE-------RRRLCYSVLFHCAAALCVIWSL-- 136

  Fly   134 DIFSVENLASDAFRGCF---------VVTCTLLSFIGLVWLREQ------ILHGGGPDWLERD-- 181
             ...:|..|.|..||..         |||..|..  |:|::..|      :.|    .|..|:  
  Fly   137 -CVLIERAADDVQRGLIDWPFWTKLAVVTVGLTG--GIVFMYIQCKAYLHLCH----RWKARNRI 194

  Fly   182 ----DAPLQA-AAANPAP---------DPAAEAAPQPQDDNNNADD-------NEAP-APADNDG 224
                :||.:. ..|.|:|         :|.|.|.........||..       :||. |..||.|
  Fly   195 LLIQNAPEKIHPVAPPSPVAAHHQHFSEPLAHAGSTSGAVEINASGAAGGYCAHEANCASMDNGG 259

  Fly   225 QDAQ 228
            ..|:
  Fly   260 GGAE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1317NP_001163328.1 RINGv 9..56 CDD:128983 24/46 (52%)
DotA_TraY <737..913 CDD:275142
CG4080NP_001246695.1 RINGv 42..90 CDD:128983 25/47 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I2590
eggNOG 1 0.900 - - E1_COG5183
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D170933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R328
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.