DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1317 and Marchf4

DIOPT Version :9

Sequence 1:NP_001163328.1 Gene:CG1317 / 38300 FlyBaseID:FBgn0035333 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_001038998.1 Gene:Marchf4 / 381270 MGIID:2683550 Length:409 Species:Mus musculus


Alignment Length:274 Identity:55/274 - (20%)
Similarity:93/274 - (33%) Gaps:89/274 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDDLSQGDICRVCRCEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHKEYCELCSYSFSFQPI 65
            :|...:..:||:| .:......|..||.|.||:|..||.||:.|:.......||||.|.:....|
Mouse   153 LDSGMRTPLCRIC-FQGPEQGELLSPCRCDGSVKCTHQPCLIKWISERGCWSCELCYYKYHVIAI 216

  Fly    66 YAPDMPRVLPIKDVLVGL-------MSAVLEGARCWLHYTLVGLAWFGVVPLSAYRTYRYLFRAS 123
            ...:     |::...:.|       ::|.:.|:.    :.:..::|.      .:.|:....:..
Mouse   217 STKN-----PLQWQAISLTVIEKVQIAAAILGSL----FLIASISWL------IWSTFSPSAKWQ 266

  Fly   124 SFDMILTLPFDIFSVENLASDAFRGCFVVTCTLLSFIGLVWLREQILHGG-------------GP 175
            ..|::..:.:.::           |...|.|     |||      |:|.|             ..
Mouse   267 RQDLLFQICYGMY-----------GFMDVVC-----IGL------IIHEGPSVYRIFKRWQAVNQ 309

  Fly   176 DW--LERDDAP------------LQAAAANPAPDPAAEAAPQPQDDNNNADDNEAPAPADNDGQD 226
            .|  |..|...            ||.:::..|..|:||             :..|..||..:|..
Mouse   310 QWKVLNYDKTKDLEDQKSGGRTNLQTSSSAQANLPSAE-------------EEAASPPAREEGPT 361

  Fly   227 AQAQDAAPAAAAPV 240
            .    ||...:.||
Mouse   362 R----AASHPSGPV 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1317NP_001163328.1 RINGv 9..56 CDD:128983 17/46 (37%)
DotA_TraY <737..913 CDD:275142
Marchf4NP_001038998.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..133
RING_CH-C4HC3_MARCH4_9 161..211 CDD:319725 20/50 (40%)
RING-CH finger (C4HC3-type) 162..207 CDD:319725 17/45 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 323..372 14/66 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..409
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.