powered by:
Protein Alignment CG1317 and Marchf10
DIOPT Version :9
| Sequence 1: | NP_001163328.1 |
Gene: | CG1317 / 38300 |
FlyBaseID: | FBgn0035333 |
Length: | 988 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001013995.1 |
Gene: | Marchf10 / 303596 |
RGDID: | 1311692 |
Length: | 790 |
Species: | Rattus norvegicus |
| Alignment Length: | 64 |
Identity: | 23/64 - (35%) |
| Similarity: | 36/64 - (56%) |
Gaps: | 9/64 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 DDLSQGDICRVCR-CEAQPDRPLFYPCICTGSIKYIHQDCLMLWMR--------YSHKEYCELC 56
|...:||:||:|: ....|..||..||.|.||::::||:||..|:: .|..:.||:|
Rat 633 DSEEEGDLCRICQIAGGSPANPLLEPCGCVGSLQFVHQECLKKWLKVKITSGADLSTVKTCEMC 696
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5183 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.