DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG1317 and Marchf2

DIOPT Version :9

Sequence 1:	NP_001163328.1	Gene:	CG1317 / 38300	FlyBaseID:	FBgn0035333	Length:	988	Species:	Drosophila melanogaster
Sequence 2:	NP_663461.2	Gene:	Marchf2 / 224703	MGIID:	1925915	Length:	287	Species:	Mus musculus

Alignment Length:	151	Identity:	44/151 - (29%)
Similarity:	63/151 - (41%)	Gaps:	39/151 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MDDLSQGDICRVCRCEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHKEYCELCSYSFSFQPI 65
            :|..|....||:|. |......|..||.|||::..:|:.||..|:..|:..|||||...|:.:
Mouse    55 LDSQSDCPFCRICH-EGANGENLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVE-- 116

  Fly    66 YAPDMPRVLP--IKD-----------------VLVGLMSAV-----LEGAR--CWLHYTL--VGL 102
               ..||.|.  :||                 |.:..::|:     |.||:  ..||..|  |||
Mouse   117 ---KRPRPLTEWLKDPGPRTEKRTLCCDMVCFVFITPLAAISGWLCLRGAQDHLRLHSRLEAVGL 178

  Fly   103 -----AWFGVVPLSAYRTYRY 118
                 |.|.:..|....::||
Mouse   179 IALTIALFTIYVLWTLVSFRY 199

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG1317	NP_001163328.1	RINGv	9..56	CDD:128983	18/46 (39%)
CG1317	NP_001163328.1	DotA_TraY	<737..913	CDD:275142
Marchf2	NP_663461.2	RINGv	63..110	CDD:128983	19/47 (40%)
Marchf2	NP_663461.2	Vpu	173..>224	CDD:109608	9/27 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5183
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900