DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1317 and marc-2

DIOPT Version :9

Sequence 1:NP_001163328.1 Gene:CG1317 / 38300 FlyBaseID:FBgn0035333 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_496302.2 Gene:marc-2 / 183961 WormBaseID:WBGene00008433 Length:206 Species:Caenorhabditis elegans


Alignment Length:103 Identity:30/103 - (29%)
Similarity:43/103 - (41%) Gaps:9/103 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ICRVCRCEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHKEYCELCSYSFSFQPIYAPD---- 69
            |||:|.........|..||.|:|::.|:|..||..|:|.:....|.:|...|...|....|    
 Worm    24 ICRICFDNDTSSDSLIKPCSCSGTVAYVHNGCLEQWVRTTSNIQCTICQDMFELIPAGLKDWNKI 88

  Fly    70 -MPRVLPIKDVLVGLM--SAVLEGARCWLHYTLVGLAW 104
             :||  |:.:.|...|  ...|......|.:..|||.:
 Worm    89 TLPR--PLSEQLEDYMEFGCTLAWVVYMLRFAYVGLRY 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1317NP_001163328.1 RINGv 9..56 CDD:128983 16/46 (35%)
DotA_TraY <737..913 CDD:275142
marc-2NP_496302.2 RINGv 24..72 CDD:128983 16/47 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.