DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1317 and AgaP_AGAP001041

DIOPT Version :9

Sequence 1:NP_001163328.1 Gene:CG1317 / 38300 FlyBaseID:FBgn0035333 Length:988 Species:Drosophila melanogaster
Sequence 2:XP_003437184.1 Gene:AgaP_AGAP001041 / 1270534 VectorBaseID:AGAP001041 Length:352 Species:Anopheles gambiae


Alignment Length:175 Identity:40/175 - (22%)
Similarity:68/175 - (38%) Gaps:37/175 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CRVCRCEAQPDR--PLFYPCICTGSIKYIHQDCLMLWMRYSHK--EY----CELCSYSFSFQPIY 66
            |.||....:.|:  |...||.|.|:.|::||.||..|:....|  .|    |..|...:.   |.
Mosquito    47 CWVCFATEEDDKVAPWVQPCNCRGATKWVHQSCLKRWIDEKQKGNPYKSISCPQCQTRYI---II 108

  Fly    67 APDMPR---VLPIKDVLVGLMS-AVLEGA-RCWLHYTLVGLAWFGVVPLSAY-RTYRYLFRASSF 125
            .|.|..   :|...|::...:| .:..|| .|.::::.:......|:..:.: |....:.:|...
Mosquito   109 LPTMGSFAFLLERLDIIAKQLSPGMAAGAIVCSIYWSAITFGAVTVLQTTGFERGLSMMEQAEPI 173

  Fly   126 DMILTLPFDIFSVENLASDAFRGCFVVTCTLLSFIGLVWLREQIL 170
            .::|.||                    |..:|..||.::..|.|:
Mosquito   174 ALLLCLP--------------------TIPVLLVIGRMFRWEDIV 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1317NP_001163328.1 RINGv 9..56 CDD:128983 18/53 (34%)
DotA_TraY <737..913 CDD:275142
AgaP_AGAP001041XP_003437184.1 RINGv 46..102 CDD:128983 18/54 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.