DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1317 and MARCHF3

DIOPT Version :9

Sequence 1:NP_001163328.1 Gene:CG1317 / 38300 FlyBaseID:FBgn0035333 Length:988 Species:Drosophila melanogaster
Sequence 2:XP_011541430.1 Gene:MARCHF3 / 115123 HGNCID:28728 Length:305 Species:Homo sapiens


Alignment Length:274 Identity:49/274 - (17%)
Similarity:79/274 - (28%) Gaps:104/274 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 FVVTCTLLSFIGLVWLREQILHGGGPDWLERDDAPL-QAAAANP-----------APDPAAEAAP 202
            :::..|.|.|    |      :.|||...::....: ...||.|           ||.|......
Human    33 WIILATRLGF----W------NPGGPKRQQKSPQRMPPRTAARPERRSHRFRRRRAPKPPVGRQL 87

  Fly   203 QPQDDNNNADD--------------NEAPAPADNDGQDAQAQDAAPAAAAPVVDADADEQN--WN 251
            .|:...:...|              :...|...:|.|..|:...:||....:.....::..  |.
Human    88 CPRRAGSGGGDPRRRWKSCMNVEAISRVIAVCYHDNQPLQSPARSPARLHQLSCTRGEDGGGLWQ 152

  Fly   252 PMEWDRAAEELTWERLLGLDGSLVFLEHVFWIISLNTMFIFTFAFCPYCVGNF-------ILSSM 309
            |.||..|.                                        |..:|       :.||.
Human   153 PSEWAAAV----------------------------------------CHASFSQGRAAAVNSSA 177

  Fly   310 DLLQP----------EKPLLHFHGLITTLF--------GYCCIGLTLVVLHFFSRVFRLRRVCWF 356
            |...|          ||..| |..::..||        |:.|:...:..|||.||:..:..:...
Human   178 DSCHPEWLRNPGPQHEKRTL-FGDMVCFLFITPLATISGWLCLRGAVDHLHFSSRLEAVGLIALT 241

  Fly   357 IGLCYIVVKVSLLS 370
            :.|..|.:..:|:|
Human   242 VALFTIYLFWTLVS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1317NP_001163328.1 RINGv 9..56 CDD:128983
DotA_TraY <737..913 CDD:275142
MARCHF3XP_011541430.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.