DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1317 and march4l

DIOPT Version :9

Sequence 1:NP_001163328.1 Gene:CG1317 / 38300 FlyBaseID:FBgn0035333 Length:988 Species:Drosophila melanogaster
Sequence 2:NP_001038876.1 Gene:march4l / 100000640 ZFINID:ZDB-GENE-060825-323 Length:421 Species:Danio rerio


Alignment Length:265 Identity:57/265 - (21%)
Similarity:97/265 - (36%) Gaps:72/265 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ICRVCRCEAQPDRPLFYPCICTGSIKYIHQDCLMLWMRYSHKEYCELCSYSFSFQPIYAPDMPRV 73
            :||:| .:......|..||.|:||::..|:.||:.|:.......||||.|.:....|...:    
Zfish   142 LCRIC-FQGPEQGELLSPCRCSGSVRCTHEPCLIKWISERGSWSCELCYYKYQVIAISTKN---- 201

  Fly    74 LPIKDVLVGL-------MSAVLEGARCWLHYTLVGLAWFGVVPLSAYRTYRYLFRA-----SSFD 126
             |::...:.|       ::|.:.|: .:|..::..|.|..:.|.:.::....||:.     ...|
Zfish   202 -PLQWQAISLTVIEKVQIAAAVLGS-LFLIASISWLVWSSLSPSAKWQRQDLLFQICYAMYGFMD 264

  Fly   127 MILTL--------PFDIFS----------------VENLASDAFRGCFVVTCTLLSFIGLVWLRE 167
            ::...        .|.||:                |::.......|....|.:|           
Zfish   265 LVCIALIVHEGPSVFRIFNRWQAVNQQWKVLNYDKVKDNEDHQKTGATFRTLSL----------- 318

  Fly   168 QILHGGGPDWLERD----DAPLQAAAA-----------NPAPDPAAEAAPQPQDDNNNADDNEAP 217
            .:.|..|....|.:    .:.|.||||           |..| |||.|..:|||  ::...|..|
Zfish   319 PLTHRMGQSGPEGEPSTSTSSLMAAAAAAAAGTVTPTTNSVP-PAAGATTEPQD--SSEPSNGQP 380

  Fly   218 APADN 222
            :..|:
Zfish   381 SLPDH 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1317NP_001163328.1 RINGv 9..56 CDD:128983 15/46 (33%)
DotA_TraY <737..913 CDD:275142
march4lNP_001038876.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..79
RINGv 143..188 CDD:128983 15/45 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 319..385 19/68 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..421
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.