| Sequence 1: | NP_728732.1 | Gene: | CG32302 / 38293 | FlyBaseID: | FBgn0052302 | Length: | 313 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001262093.1 | Gene: | CG7290 / 40211 | FlyBaseID: | FBgn0036949 | Length: | 419 | Species: | Drosophila melanogaster | 
| Alignment Length: | 357 | Identity: | 76/357 - (21%) | 
|---|---|---|---|
| Similarity: | 123/357 - (34%) | Gaps: | 92/357 - (25%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly    10 ILLALALGSAWANDNPCQDVRIPGFVCMNCTTLGYCIRDATGSW---------------ETISML 59 
  Fly    60 GCQSEYNF-----YCSDEGTFGCTFQSQ-CQVPKRGPFSCQQAGLFPDPYDCRRYHECSDQSVDT 118 
  Fly   119 PRICSNGAGYSTLTGTCVLPRESEQCIQEQFTCSRSGQVGGWAP---------DNRYFYVCVNDT 174 
  Fly   175 A-------NSLYPLMMKCHEGFVFN----------SYSC--VPDTRSMRSIQAMESHTCMNNDRY 220 
  Fly   221 QCPFRTSEIEYCKCVDGELEVMTCPAGFQIDPKILTCVTDRIYQCSDFE--------ILSCPNVS 277 
  Fly   278 TKDEYCICIDH-QLQIYSCPMGQYFNAETRKC 308  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG32302 | NP_728732.1 | CBM_14 | 94..144 | CDD:279884 | 8/49 (16%) | 
| CG7290 | NP_001262093.1 | CBM_14 | 32..77 | CDD:279884 | 5/44 (11%) | 
| CBM_14 | 91..142 | CDD:279884 | 11/66 (17%) | ||
| CBM_14 | 160..207 | CDD:279884 | 9/48 (19%) | ||
| CBM_14 | 234..277 | CDD:279884 | 14/45 (31%) | ||
| ChtBD2 | <296..331 | CDD:214696 | 10/35 (29%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45444194 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR23301 | 
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.030 | |||||