powered by:
Protein Alignment CG13807 and RAMAC
DIOPT Version :9
| Sequence 1: | NP_647706.1 |
Gene: | CG13807 / 38290 |
FlyBaseID: | FBgn0035323 |
Length: | 170 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_113640.1 |
Gene: | RAMAC / 83640 |
HGNCID: | 31022 |
Length: | 118 |
Species: | Homo sapiens |
| Alignment Length: | 152 |
Identity: | 41/152 - (26%) |
| Similarity: | 55/152 - (36%) |
Gaps: | 61/152 - (40%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 26 FADRFTDDDPEFMAHCSKPVPEPPIVENWMGGGGGGGGFQGGGGGGHPYHNRYNGHRRGGGDRGW 90
||.|||::|.|:..:..:|...|||||.| :.|.||::
Human 15 FASRFTENDKEYQEYLKRPPESPPIVEEW--------------------------NSRAGGNQ-- 51
Fly 91 QRRGGAGYHNNQDRGFRDNRRNNRYDHIDRRNRYEGGGGSGGSGGYKRSHDHN--QRNDTP---- 149
:.||.....|.|.|| ||||.....| :|.|::.| ||..:| |....|
Human 52 RNRGNRLQDNRQFRG-RDNRWGWPSD--NRSNQWHG-----------RSWGNNYPQHRQEPYYPQ 102
Fly 150 -------NNEPPMKVRRDYGNF 164
|..|| ||.:
Human 103 QYGHYGYNQRPP------YGYY 118
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
O |
PTHR48168 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
1 |
0.960 |
- |
- |
|
|
| User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.970 |
|
Return to query results.
Submit another query.