DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SCOT and Oxct1

Sequence 1:NP_647683.1 Gene:SCOT FlyBaseID:FBgn0035298 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001121052.1 Gene:Oxct1 RGDID:1584008 Length:520 Species:Rattus norvegicus

Alignment Length:513 Identity:311/514 (61%)
Similarity:395/514 (77%) Gaps:7/514 (1%)


  Fly     2 LCRLVGNRSLGARYTASIKAIACYSTSGKQRNGKIYESAIDAVADVQDGAQILFGGFGICGIPEK 66
            ||....| |.||.:    |..|||.:...:.:.|.|...::||.|:.:||.:|.||||:|||||.
  Rat    13 LCASARN-SRGALH----KGCACYFSVSTRHHTKFYTDPVEAVKDIPNGATLLVGGFGLCGIPEN 72

  Fly    67 MINALKQKGVKNITGVSNNGGVDDTGLGVLIKQKQVSKVIGSYVGENTELVRQYLEGELAVELTP 131
            :|.||.:.|||::|.||||.|||:.|||:|::.||:.::|.||||||.|..||:|.|||.|||||
  Rat    73 LIGALLKTGVKDLTAVSNNAGVDNFGLGLLLRSKQIKRMISSYVGENAEFERQFLSGELEVELTP 137

  Fly   132 QGTLAEKIRAGGAGIPAFYTPTGYATLVQEGGAPIKYSKDGKVEISSEKKPVKEFNGKNYVMEES 196
            ||||||:|||||||:|||||.|||.|||||||:||||:|||.|.|:|:.:.|:||.|:::::||:
  Rat   138 QGTLAERIRAGGAGVPAFYTSTGYGTLVQEGGSPIKYNKDGSVAIASKPREVREFRGQHFILEEA 202

  Fly   197 IFADFAFVKAQKADPLGNLVFNKAARNFNAPMCRAAKITVAEVEEIVPIGALSPDEIHVPGIYIN 261
            |..|||.|||.|||..||::|.|:|||||.|||:||..||.||||||.||:.:|::||:|.||::
  Rat   203 ITGDFALVKAWKADRAGNVIFRKSARNFNLPMCKAAGTTVVEVEEIVDIGSFAPEDIHIPKIYVH 267

  Fly   262 RIFKGTNYNKRVERLRITEPKDPSKPAPPPNPAQVLRERIARRVALEFHDGMYANLGIGIPVLSS 326
            |:.||..|.||:|||.:.  |:....|....|.:.:||||.:|.||||.||||||||||||:|:|
  Rat   268 RLIKGEKYEKRIERLSLR--KEGEGKAKSGKPGEDVRERIIKRAALEFEDGMYANLGIGIPLLAS 330

  Fly   327 NYIPKGMNVMLQSENGILGLGPFPTKDKVDPDLINAGKESVTVVPGASYFGSDDSFAMIRGGHVD 391
            |:|...|.|.||||||:|||||:|.||:.|.||||||||:|||:||||:|.||:||||||||||:
  Rat   331 NFISPNMTVHLQSENGVLGLGPYPLKDEADADLINAGKETVTVLPGASFFSSDESFAMIRGGHVN 395

  Fly   392 ITILGAMEVSATGDLANWMIPGKLVKGMGGAMDLVAAPGTKVIITMEHNARDGSPKILDTCSLPL 456
            :|:||||:||..|||||||||||:|||||||||||::..|||::||||:|:..:.||::.|:|||
  Rat   396 LTMLGAMQVSKYGDLANWMIPGKMVKGMGGAMDLVSSSKTKVVVTMEHSAKGNAHKIMEKCTLPL 460

  Fly   457 TGKGVIDMIISEKAVFTVEKGVGLTLIEVAEGYTVDDIIASTGAKFTVSPNLKKMGQI 514
            |||..::.||:||.||.|:|..||||||:.||.|||||..|||..|.|||||..|.||
  Rat   461 TGKQCVNRIITEKGVFDVDKKNGLTLIELWEGLTVDDIRKSTGCDFAVSPNLMPMQQI 518

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCOTNP_647683.1 AtoD 35..268 CDD:224702 143/233 (61%)
pcaJ_scoB_fam 298..504 CDD:188219 141/206 (68%)
Oxct1NP_001121052.1 AtoD 41..274 CDD:224702 143/233 (61%)
YdiF 48..517 CDD:227016 297/471 (63%)
SugarP_isomerase 300..508 CDD:294243 141/208 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C270027509
eggNOG 1 0.900 E1_COG2057
Hieranoid 1 1.000
Homologene 1 1.000 H377
Inparanoid 1 1.050 626 1.000 Inparanoid score I802
OMA 1 1.010
OrthoDB 1 1.010 D332119at33208
OrthoFinder 1 1.000 FOG0001576
OrthoInspector 1 1.000 T619170
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13707
Phylome 1 0.910 0.750 Consistency score
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.