DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SCOT and oxct1

Sequence 1:NP_647683.1 Gene:SCOT FlyBaseID:FBgn0035298 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001007927.1 Gene:oxct1 XenbaseID:XB-GENE-976566 Length:530 Species:Xenopus tropicalis

Alignment Length:505 Identity:316/506 (62%)
Similarity:405/506 (80%) Gaps:2/506 (0%)


  Fly    10 SLGARYTASIKAIACYSTSGKQRNGKIYESAIDAVADVQDGAQILFGGFGICGIPEKMINALKQK 74
            |:.|.:....|:.:||.::..||:.|.|...::||.|:.||:.:|.||||:|||||.:|..|.:.
 Frog    26 SVSAAWIGQNKSCSCYFSTSNQRHSKFYSDPVEAVKDIPDGSTLLVGGFGLCGIPENLIAGLLKT 90

  Fly    75 GVKNITGVSNNGGVDDTGLGVLIKQKQVSKVIGSYVGENTELVRQYLEGELAVELTPQGTLAEKI 139
            |||.||.||||.|||:.|||:|::.||:.:::.||||||.|..||||||||.|||.|||||||::
 Frog    91 GVKGITAVSNNAGVDNFGLGLLLQTKQIKRMVSSYVGENAEFERQYLEGELEVELVPQGTLAERV 155

  Fly   140 RAGGAGIPAFYTPTGYATLVQEGGAPIKYSKDGKVEISSEKKPVKEFNGKNYVMEESIFADFAFV 204
            ||||||||||:|||||.||:|||||||||:|||.:.|:|:.|.||||||:::|||.||..|:|.|
 Frog   156 RAGGAGIPAFFTPTGYGTLIQEGGAPIKYNKDGTIAIASQPKEVKEFNGRHFVMEPSITGDYALV 220

  Fly   205 KAQKADPLGNLVFNKAARNFNAPMCRAAKITVAEVEEIVPIGALSPDEIHVPGIYINRIFKGTNY 269
            ||.|||..||:||.|.|||||.|||:|||:||.||||||..|..:|:::|:|.||::|:.||..|
 Frog   221 KAWKADRAGNVVFRKTARNFNQPMCKAAKVTVVEVEEIVETGTFAPEDVHIPSIYVDRVIKGDGY 285

  Fly   270 NKRVERLRITEPKDPSKPAPPPNPAQVLRERIARRVALEFHDGMYANLGIGIPVLSSNYIPKGMN 334
            .|::|||.:.:.:: |||.|..: :.::||||.||.||||.||||||||||||:|:||:|.|.:.
 Frog   286 QKKIERLTLRKSEN-SKPKPKKD-SDIVRERIIRRAALEFQDGMYANLGIGIPMLASNFIKKDIT 348

  Fly   335 VMLQSENGILGLGPFPTKDKVDPDLINAGKESVTVVPGASYFGSDDSFAMIRGGHVDITILGAME 399
            |.||||||:|||||:|.:::|||||||||||:|||:|||:||.||||||||||||||:|:||||:
 Frog   349 VHLQSENGVLGLGPYPLQEEVDPDLINAGKETVTVLPGAAYFSSDDSFAMIRGGHVDLTMLGAMQ 413

  Fly   400 VSATGDLANWMIPGKLVKGMGGAMDLVAAPGTKVIITMEHNARDGSPKILDTCSLPLTGKGVIDM 464
            ||..|||||||||||:|||||||||||::.||||::||||:|:.||.|||:.|:||||||..:|.
 Frog   414 VSKYGDLANWMIPGKMVKGMGGAMDLVSSSGTKVVVTMEHSAKGGSHKILEQCNLPLTGKQCVDR 478

  Fly   465 IISEKAVFTVEKGVGLTLIEVAEGYTVDDIIASTGAKFTVSPNLKKMGQI 514
            ||:|||||.|::..||||||:|||.:||||...||..|.||.:||::.||
 Frog   479 IITEKAVFDVDRKNGLTLIEIAEGLSVDDIKKCTGCNFAVSSDLKQLQQI 528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCOTNP_647683.1 AtoD 35..268 CDD:224702 146/233 (63%)
pcaJ_scoB_fam 298..504 CDD:188219 148/206 (72%)
oxct1NP_001007927.1 AtoD 50..284 CDD:224702 146/234 (62%)
pcaJ_scoB_fam 311..518 CDD:188219 148/207 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H377
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D332119at33208
OrthoFinder 1 1.000 FOG0001576
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.