DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SCOT and C05C10.3

Sequence 1:NP_647683.1 Gene:SCOT FlyBaseID:FBgn0035298 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_496144.1 Gene:C05C10.3 WormBaseID:WBGene00007330 Length:521 Species:Caenorhabditis elegans

Alignment Length:503 Identity:297/504 (59%)
Similarity:372/504 (74%) Gaps:18/504 (4%)


  Fly    16 TASIKAIACYSTSGKQRNGKIYESAIDAVADVQDGAQILFGGFGICGIPEKMINALKQKGVKNIT 80
            |:|:||             |::.||.:||.|:.|.|::|.||||:|||||.:|.|:.:.|.|.:|
 Worm    32 TSSMKA-------------KVFNSAEEAVKDIPDNAKLLVGGFGLCGIPENLIQAITKTGQKGLT 83

  Fly    81 GVSNNGGVDDTGLGVLIKQKQVSKVIGSYVGENTELVRQYLEGELAVELTPQGTLAEKIRAGGAG 145
            .||||.|||:.|||:|::.:|:.|:|.||||||.|..||||.|||.:|.||||||||:|||.|||
 Worm    84 CVSNNAGVDNWGLGLLLQTRQIKKMISSYVGENGEFARQYLSGELELEFTPQGTLAERIRAAGAG 148

  Fly   146 IPAFYTPTGYATLVQEGGAPIKYSK--DGKVEISSEKKPVKEFNGKNYVMEESIFADFAFVKAQK 208
            :|||||||||.|.:|||||||||||  .||:|::|:.|..::|||.||||||:|:.|||.:||.:
 Worm   149 VPAFYTPTGYGTQIQEGGAPIKYSKTEKGKIEVASKAKETRQFNGINYVMEEAIWGDFALIKAWR 213

  Fly   209 ADPLGNLVFNKAARNFNAPMCRAAKITVAEVEEIVPIGALSPDEIHVPGIYINRIFKGTNYNKRV 273
            ||.|||:.|..||.|||.|||:|:|.|:.||||||..|.::|:::|:|.||.:|:..|.||.|.:
 Worm   214 ADTLGNIQFRHAAGNFNNPMCKASKCTIVEVEEIVEPGVIAPNDVHIPSIYCHRLVLGKNYKKPI 278

  Fly   274 ERLRITEPKDPSKPAPPPNPAQVLRERIARRVALEFHDGMYANLGIGIPVLSSNYIPKGMNVMLQ 338
            ||..... :.|.||:  .:.|...||.||.|.||||.||||||||||||.|:.||||.|..|.||
 Worm   279 ERPMFAH-EGPIKPS--TSAAGKSREIIAARAALEFTDGMYANLGIGIPTLAPNYIPNGFTVHLQ 340

  Fly   339 SENGILGLGPFPTKDKVDPDLINAGKESVTVVPGASYFGSDDSFAMIRGGHVDITILGAMEVSAT 403
            |||||:|:||:|.|...|.||||||||.:|::.|||..|||:|||||||.|:|||:|||::.|..
 Worm   341 SENGIIGVGPYPRKGTEDADLINAGKEPITLLKGASIVGSDESFAMIRGSHMDITVLGALQCSQF 405

  Fly   404 GDLANWMIPGKLVKGMGGAMDLVAAPGTKVIITMEHNARDGSPKILDTCSLPLTGKGVIDMIISE 468
            |||||||||||||||||||||||:|||.:||:.|||.:::|.||||:.|.|||||||||..||::
 Worm   406 GDLANWMIPGKLVKGMGGAMDLVSAPGARVIVVMEHVSKNGEPKILEHCELPLTGKGVISRIITD 470

  Fly   469 KAVFTVEKGVGLTLIEVAEGYTVDDIIASTGAKFTVSPNLKKMGQIPV 516
            .|||.|:...|||||||.:..|||||...|..||.:|.|||.|||.|:
 Worm   471 MAVFDVDTKNGLTLIEVRKDLTVDDIKKLTACKFEISENLKPMGQAPL 518

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCOTNP_647683.1 AtoD 35..268 CDD:224702 138/235 (59%)
pcaJ_scoB_fam 298..504 CDD:188219 138/206 (67%)
C05C10.3NP_496144.1 YdiF 35..516 CDD:227016 294/497 (59%)
AtoD 37..273 CDD:224702 139/249 (56%)
SugarP_isomerase 299..506 CDD:294243 138/207 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C270025514
eggNOG 1 0.900 E1_COG2057
Hieranoid 1 1.000
Homologene 1 1.000 H377
Inparanoid 1 1.050 588 1.000 Inparanoid score I536
Isobase 1 0.950 0 Normalized mean entropy S2149
OMA 1 1.010
OrthoDB 1 1.010 D332119at33208
OrthoFinder 1 1.000 FOG0001576
OrthoInspector 1 1.000 T476400
orthoMCL 1 0.900 OOG5_127302
Panther 1 1.100 LDO PTHR13707
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2787
TreeFam 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.