DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SCOT and LOC100361036

Sequence 1:NP_647683.1 Gene:SCOT FlyBaseID:FBgn0035298 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_008762334.1 Gene:LOC100361036 RGDID:2320924 Length:552 Species:Rattus norvegicus

Alignment Length:527 Identity:289/528 (55%)
Similarity:377/528 (71%) Gaps:26/528 (5%)


  Fly     7 GNRSLGA-----------------RYTASIKAIACYSTSGKQRNGKI--YESAIDAVADVQDGAQ 52
            |:|::.|                 |.|.....|..|.|:   |.||:  |...:.||..::|||.
  Rat    29 GSRTMAALRLLAWAFSRRVSAHRPRPTLPHHLIRHYPTT---RCGKVKFYTDPVKAVEGIKDGAS 90

  Fly    53 ILFGGFGICGIPEKMINALKQKGVKNITGVSNNGGVDDTGLGVLIKQKQVSKVIGSYVGENTELV 117
            ::.||||:|||||.:|.|||.||||::..:|:|.||||.|||:|:..|||.:|:.||:|||....
  Rat    91 VMLGGFGLCGIPENLIGALKTKGVKDLKIISSNVGVDDFGLGILLASKQVRRVVCSYLGENKLCE 155

  Fly   118 RQYLEGELAVELTPQGTLAEKIRAGGAGIPAFYTPTGYATLVQEGGAPIKYSKDGKVEISSEKKP 182
            :.||.|:|.:|:||||||||:|||||.|:|||||||||.|.|||||.||:||.:|.:...|:.:.
  Rat   156 QLYLAGKLELEMTPQGTLAERIRAGGTGVPAFYTPTGYGTQVQEGGVPIRYSPEGHLITLSQPRE 220

  Fly   183 VKEFNGKNYVMEESIFADFAFVKAQKADPLGNLVFNKAARNFNAPMCRAAKITVAEVEEIVPIGA 247
            |:||.|:::::|.:|.||||.:|..|||..||::|..:|||||.|||:||.|:|.||||||.:|.
  Rat   221 VREFEGQHHLLERAIRADFALIKGWKADRSGNVIFRGSARNFNVPMCKAADISVVEVEEIVDVGT 285

  Fly   248 LSPDEIHVPGIYINRIFKGTNYNKRVERLRITEPKDPSKPAPPPNPAQVLRERIARRVALEFHDG 312
            .:|::||:|.||:.|:.||..:.||:|||...:    |.|||........|.||.:|.||||.||
  Rat   286 FAPEDIHIPNIYVKRVIKGPRFEKRIERLTTRD----SPPAPGSKDQDPKRTRIIKRAALEFKDG 346

  Fly   313 MYANLGIGIPVLSSNYIPKGMNVMLQSENGILGLGPFPTKDKVDPDLINAGKESVTVVPGASYFG 377
            ||||||||||||:||||...|.|.|.||||||||||||.|.:||||:|||||::|||:||..:|.
  Rat   347 MYANLGIGIPVLASNYISPKMTVYLHSENGILGLGPFPLKKEVDPDIINAGKQTVTVIPGGCFFA 411

  Fly   378 SDDSFAMIRGGHVDITILGAMEVSATGDLANWMIPGKLVKGMGGAMDLVAAPGTKVIITMEHNAR 442
            ||||||||||||:.:|:||||:||..|||||||:|||.|||||||||||::..|||::||||..:
  Rat   412 SDDSFAMIRGGHIQLTMLGAMQVSKYGDLANWMVPGKKVKGMGGAMDLVSSKKTKVVVTMEHCTK 476

  Fly   443 DGSPKILDTCSLPLTGKGVIDMIISEKAVFTVEKGVGLTLIEVAEGYTVDDIIASTGAKFTVSPN 507
            ...||||:.|::|||||..:|:||:|||||.|::..||.|:|:.||.::|::.|:||..|.|.||
  Rat   477 TKQPKILEKCTMPLTGKSCVDLIITEKAVFEVDRSKGLKLVELWEGSSLDEVKATTGCSFKVCPN 541

  Fly   508 LKKMGQI 514
            ||.|.||
  Rat   542 LKPMQQI 548

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCOTNP_647683.1 AtoD 35..268 CDD:224702 128/235 (54%)
pcaJ_scoB_fam 298..504 CDD:188219 134/206 (65%)
LOC100361036XP_008762334.1 YdiF 70..547 CDD:227016 278/481 (58%)
AtoD 81..305 CDD:224702 126/224 (56%)
SugarP_isomerase 332..538 CDD:294243 134/206 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D332119at33208
OrthoFinder 1 1.000 FOG0001576
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.