DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dsb and santa-maria

Sequence 1:NP_001097477.1 Gene:dsb FlyBaseID:FBgn0035290 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_609121.2 Gene:santa-maria FlyBaseID:FBgn0025697 Length:563 Species:Drosophila melanogaster

Alignment Length:497 Identity:146/498 (29%)
Similarity:237/498 (48%) Gaps:53/498 (11%)


  Fly    43 PSQGSTATGRRSRPHVTHRGTPLSMLISNGVRISNNRLAVIIIGIITLILGI--ILSSMPWLDYF 105
            |:|.|...|::                      ||.:|   ||||....||:  ||..|.|:|.|
  Fly     2 PTQNSAMWGQK----------------------SNRKL---IIGIFGFCLGLFGILCGMFWVDLF 41

  Fly   106 ---ILKNLRLWNDTLSYHYWQRPGVIRLTKLYIYNVTNPDGFLR-GEKPHLQEVGPFVYREDMQK 166
               :.|.:.|..||..|..|:.|.:.....:|:||.|||:.|.. ..||.|::|||:.:.|...|
  Fly    42 DWIMHKEMALAPDTRVYENWKSPPIDLSLDIYLYNWTNPEDFGNLSTKPILEQVGPYRFIERPDK 106

  Fly   167 VNVKFHENNYTVSYQHKKILQFVPELSIDK-DTPITTPNIPLLTLTSLSPKLGYLLSKTISVVVT 230
            |::.:|..|.:|:|:.:.:..|....|... |..|||.|...|:..:.:.....:....:.|.:.
  Fly   107 VDIHWHPENASVTYRRRSLFYFDAAGSNGSLDDEITTLNAVALSAAATAKYWPPVKRSLVDVGLK 171

  Fly   231 AAQFKPFINVTAEQLAF-GYDDALVSLAHR---FYPKHMRPMERMGLLLGRNGT--LTEVSSVKT 289
            ....:..:..:.::|.| ||:||::.:|..   |..:...|.::.|....|||:  ||.|.:|.|
  Fly   172 MYGAEMSVQKSIDELLFTGYNDAMIDVAMAMPIFGDEVKVPFDKFGWFYTRNGSADLTGVFNVFT 236

  Fly   290 GMDSMDQFGYIDQLNGLDHLPHWSEPPCTSIAGSEGSFFPPRELTKSEVVHIYDKDLCRIIPLKY 354
            |.|.:.:.|.:...|..::...: :..|....||.|. |.|:.|...:.|.::..|:||.|||.|
  Fly   237 GADQLAKLGQMHSWNYQENTGFF-DSYCGMTNGSAGE-FQPQHLKPGDSVGLFTPDMCRTIPLDY 299

  Fly   355 VESLEKDGIAADLFRLPNNSYGDSAHNPENKCYDTSEYEPIQGLQNISPCQYGAPVYISNPHFFE 419
            ||:::.:|:....|.....|..:....|||.|:...:..| .|:.|||.|::|:||::|.||||.
  Fly   300 VETVDIEGLEGYKFSGGPRSVDNGTQYPENLCFCGGQCVP-SGVMNISSCRFGSPVFMSYPHFFN 363

  Fly   420 SHPDLLNSVEGLKPEREKHETYFKIQPKLGVPLEGKVRIQLNLKVTRAKDVYPVRDFRDFVFPVM 484
            :.|...:.||||.|.::.||.|..:||..|:|||...|.|:|:.|...:.:..........||::
  Fly   364 ADPYYPDQVEGLSPNQKDHEFYMVVQPSTGIPLEVAARFQVNMLVEPIQGISLYTGIPRIFFPLV 428

  Fly   485 WLEEGISELTPAIKRWIYLGTVIAPSAVPIGSYLMILGGAFA 526
            |.|:.: .:||.:...:        ..:||   :|:.|..||
  Fly   429 WFEQKV-RITPDMADQL--------KVLPI---VMLSGHIFA 458

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dsbNP_001097477.1 CD36 103..532 CDD:279474 129/436 (30%)
santa-mariaNP_609121.2 CD36 23..474 CDD:279474 135/452 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50685692
eggNOG 1 0.900 E1_KOG3776
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I2712
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1106566at2759
OrthoFinder 1 1.000 FOG0000266
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11923
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.