DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13924 and Ccdc181

DIOPT Version :8

Sequence 1:NP_001189024.1 Gene:CG13924 / 38247 FlyBaseID:FBgn0035286 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_083391.2 Gene:Ccdc181 / 74895 MGIID:1922145 Length:509 Species:Mus musculus

Alignment Length:525 Identity:114/526 (22%)
Similarity:188/526 (36%) Gaps:152/526 (29%)


  Fly     7 EMGEREPESDEDCEVYFLKPVNEYNIVDRIKEANKELFALDDEASNGNGKVTKVKFALNLED--- 68
            |.||.|.:.::|.|..    :|                  |.|.|||    :.::.|...||   
Mouse    11 ESGEYEDDFEKDLEWL----IN------------------DKEKSNG----STIEMACKKEDDLD 49

  Fly    69 ---------YEPTEQQKDLSPSPPDELLQQLTQL-------KLKPIAEEEPAAADETKVVETPPP 117
                     .|..:|..|...||.||.|.:....       .|.||::.:...:.:....|....
Mouse    50 QVLKENETETELGQQLSDPDNSPKDEALPRRNDFISVPSIQPLDPISDSDSENSFQDSKPENQKD 114

  Fly   118 MEEPQVDDEVEEEICEEIVDLSEV--PQQPVVQ---------------EATPIEDEDDFSGVDEA 165
            :|:.: |:||...|.|:|::.:::  .|:||..               |..|:||.|....:.|.
Mouse   115 LEDEE-DEEVRRYIMEKIIEANKLLQTQEPVNDKRERKLKFKDKLVDLEVPPLEDSDTCKALLEN 178

  Fly   166 DLDDDPPAKDSSVPGSLQLRQGTFDQDDSDQKSLTNLLTESDCEEEERTLNEARQKLRDAYKNLY 230
            :.:.........:.|            |.:|:|:...:|:..|||.:|.:...    ||....|.
Mouse   179 ETNMSGKLSQLCISG------------DLEQESVLVSVTDGSCEENDRKILVE----RDGKFELM 227

  Fly   231 KTLDPKQQETIDRLTGA------ETEVPLPAPAPVVAAVEAEEEDD----LSIIVASYIPDDFEL 285
            ...|.:.|..:..::.|      .:::||.||.|.|..::.||.:.    |.|..|.        
Mouse   228 NLQDIESQGFLPPISSANSVEHESSQLPLRAPNPSVGGIKKEESEAKGHVLPISPAG-------- 284

  Fly   286 NEQSIYYKKEEPDEVRDSCTTCPKATSKTFFTSRSFSFRRRPKPTPTLSSASASTTSPSVRMNYK 350
                      ||      ....|:...             .||..|: |:|:...|..:.|.|  
Mouse   285 ----------EP------LAQVPQLLP-------------NPKNRPS-SAANPDVTKKARRSN-- 317

  Fly   351 ICCEHRHSIQGKLPRYTGYMSEYGLTAQQLQRRDQQLRRKQRFSMEQTINRNEQELKKMQDNERA 415
                ||....|..|    ..|.|.|:.:|.:.:.|..|::::...|:...:.|:|.:|.::||..
Mouse   318 ----HRIQSAGVSP----VTSTYCLSPRQKELQKQLERKREKLKREEEQRKLEEENEKKKENEMV 374

  Fly   416 FTTWLKNKMRYPINKTRNMFDAHKRRGSVAAAGSPRQ---HPQAHPHL-----HQEQ-EQRGGRR 471
            |..||:.|....|...|      .:|.......|.||   .||....|     |:|| ::|....
Mouse   375 FKAWLQKKREQVIEMRR------VQRAKQIEDMSSRQVNRDPQQAFRLWLKKKHEEQMKERKTEE 433

  Fly   472 RRRRD 476
            .|:::
Mouse   434 LRKQE 438



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14320
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.