DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13924 and CCDC181

Sequence 1:NP_001189024.1 Gene:CG13924 FlyBaseID:FBgn0035286 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001287898.1 Gene:CCDC181 HGNCID:28051 Length:509 Species:Homo sapiens

Alignment Length:503 Identity:98/504 (19%)
Similarity:192/504 (38%) Gaps:117/504 (23%)


  Fly    27 VNEYNIVDRIK------EANKELFALDDEASNGNGKVTKVKFALNLED------------YEPTE 73
            :||....|..|      :..|:|..|.:|....:..:  ::.|...|:            .|.|:
Human     1 MNENKDTDSKKSEEYEDDFEKDLEWLINENEKSDASI--IEMACEKEENINQDLKENETVMEHTK 63

  Fly    74 QQKDLSPSPPDELLQQLTQL-------KLKPIAEEEPAAADETKVVETPPPMEEPQVDDEVEEEI 131
            :..|...|..||:..:...:       .|.||::.:...:.:...:|:...:||.: |:||...|
Human    64 RHSDPDKSLQDEVSPRRNDIISVPGIQPLDPISDSDSENSFQESKLESQKDLEEEE-DEEVRRYI 127

  Fly   132 CEEIVDLSEVPQQPVVQEATPIED--EDDFSGVDE-ADLDDDPPAKDSSV-PGSLQLRQGTFDQ- 191
            .|:||..::     ::|...|:.|  |......|: .|| :.||.:|::. ....:..:..|.: 
Human   128 MEKIVQANK-----LLQNQEPVNDKRERKLKFKDQLVDL-EVPPLEDTTTFKNYFENERNMFGKL 186

  Fly   192 ------DDSDQKSLTNLLTESDCEE-EERTLNEARQKLRDAYKNLYKTLDPKQQETIDRLTGAET 249
                  :|..|:.:...||...||| ::||:...    ||....|....|...|..:        
Human   187 SQLCISNDFGQEDVLLSLTNGSCEENKDRTILVE----RDGKFELLNLQDIASQGFL-------- 239

  Fly   250 EVPLPAPAPVVAAVEAEEEDDLSIIVASYIPDDFELNEQSIYYKKEEPDEVRDSCTTCPKATSKT 314
                    |.:....:.|.|...::..|        :..|:...|:|     ||.......|..:
Human   240 --------PPINNANSTENDPQQLLPRS--------SNSSVSGTKKE-----DSTAKIHAVTHSS 283

  Fly   315 FFTSRSFSFRRRP----KPTPTLSSASASTTSPSVRMNYKICCEHRHSIQGKLPRYTGYMSEYGL 375
              |....::..:|    |..|: |:.::..:..:.:.|::....|...:          .|.|.|
Human   284 --TGEPLAYIAQPPLNRKTCPS-SAVNSDRSKGNGKSNHRTQSAHISPV----------TSTYCL 335

  Fly   376 TAQQLQRRDQQLRRKQRFSMEQTINRNEQELKKMQDNERAFTTWLKNK------MRYPINKTRNM 434
            :.:|.:.:.|...::::...|:...:.|:|.:|.::|:..|..||:.|      || .|.:.:.:
Human   336 SPRQKELQKQLEEKREKLKREEERRKIEEEKEKKRENDIVFKAWLQKKREQVLEMR-RIQRAKEI 399

  Fly   435 FDAHKRRGSVAAAGSPRQHPQAHPHL-----HQEQ-EQRGGRRRRRRD 476
            .|.:.|:        ..:.||....|     |:|| ::|.....|:::
Human   400 EDMNSRQ--------ENRDPQQAFRLWLKKKHEEQMKERQTEELRKQE 439

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13924NP_001189024.1 None
CCDC181NP_001287898.1 DUF4207 <338..461 CDD:290615 24/112 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14320
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.