DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13924 and ccdc181

Sequence 1:NP_001189024.1 Gene:CG13924 FlyBaseID:FBgn0035286 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001122012.1 Gene:ccdc181 ZFINID:ZDB-GENE-060503-312 Length:497 Species:Danio rerio

Alignment Length:490 Identity:111/491 (23%)
Similarity:194/491 (40%) Gaps:104/491 (21%)


  Fly    57 VTKVKFALNLEDYEPTEQQKDLSPSPPDELLQQLTQLKLKPIAEEEPAAADETKVVETPPPME-- 119
            |:.||.|  :::|| .:.:|||     |.|:                  ::|:|..|..|..:  
Zfish     3 VSAVKNA--VDEYE-DDFEKDL-----DWLI------------------SEESKSEEQDPDDDDI 41

  Fly   120 EPQVDDEVEEEICEEIVDLSE------------VPQQPVVQEATPIEDE---DDFSGVDEADLDD 169
            |.|:|.|:||:..:::::..:            .|.:|:.....|..||   ......|:.||||
Zfish    42 EAQIDKELEEDDFKDVLNQHKEMDDEEGGERWPTPMEPLEDTVDPDRDELITSPHLQNDDEDLDD 106

  Fly   170 DPP-AKDSSVPGSLQLRQGTFDQDDSDQ---------KSLTNLLT---ESDCE----------EE 211
            :.. ..|.....:.||:    |||..||         .:|.:|:.   |.|.:          ||
Zfish   107 EKKYILDKIQEANKQLQ----DQDPPDQMRRRRLQFKDTLVDLVVPAHEFDAQESNIASFGDVEE 167

  Fly   212 ERTLNEARQKLRDAYKNLYKTLDPKQQETIDRLTGAETEVPLPAPA--PVVAAVEAEEEDDLSII 274
            |:.::...|:||.:.:...:..|..:.|..:  .|.|..|.:....  .:|:..|.|.:..|..:
Zfish   168 EQEVSGQMQRLRISQREENQNKDGPEDEHNE--GGKEGRVLIEKDGKFDLVSLKEVESQGLLPPL 230

  Fly   275 VASYIPDDFELNEQSIYYKKEEPDEVRDSCTTCPKATSKTFFTSRSFSFRRRPKPTPTLSSASAS 339
            ..|:  :|   |:::...:.|....:..|..:.|:....:.|...:.|. ..|||.|...: ..|
Zfish   231 PVSH--ND---NQRAPLRQTESGQHLNKSPVSSPRQNLTSPFPPSNESL-YIPKPPPKHRN-RPS 288

  Fly   340 TTSPSVRMNYKICCEHRHSIQGKLPRYTGYMSEYGLTAQQLQRRDQQLRRKQRFSMEQTINRNEQ 404
            :..||.|..:....:.|.......|.:    :.:.|:.||.:...:..:|::|.:.|..:.:.|:
Zfish   289 SARPSQRGTWVQGTKRRVQSANGAPSH----ATFTLSPQQKELLAKLQQRRERQAKEDEMKKREE 349

  Fly   405 ELKKMQDNERAFTTWLKNKMRYPINKTRNMFDAHK-----RRGSVAAAGSPRQHPQAHPHLHQEQ 464
            |.:|.|:||.||.:||..|....:.:.|    .||     |.......|.|.:..:......|||
Zfish   350 EEQKRQENEIAFQSWLMRKREQLLEERR----VHKAQEMERMSCRRDCGDPEEAFKIWLQKKQEQ 410

  Fly   465 E----QRGGRRRRRRDSG------EVEVHAYRHLL 489
            :    |....:|..:|||      |....|:|..|
Zfish   411 QFKDKQLEDMKRLEKDSGFCLHSREESEKAFRQWL 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13924NP_001189024.1 None
ccdc181NP_001122012.1 Mpp10 18..>227 CDD:281935 51/238 (21%)
DUF4207 <360..476 CDD:290615 23/91 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14320
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.