DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13924 and Ccdc181

Sequence 1:NP_001189024.1 Gene:CG13924 FlyBaseID:FBgn0035286 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001014153.1 Gene:Ccdc181 RGDID:1309708 Length:509 Species:Rattus norvegicus

Alignment Length:518 Identity:111/519 (21%)
Similarity:189/519 (36%) Gaps:138/519 (27%)


  Fly     7 EMGEREPESDEDCEVYFLKPVNEYNIVDRIKEANKELFALDDEASNGNGKVTKVKFALNLED--- 68
            |.||.|.:.::|.|..    :|                  |.|.|||    :.::.|...||   
  Rat    11 ESGEYEDDFEKDLEWL----IN------------------DKEKSNG----SMIEVACKKEDDLD 49

  Fly    69 --YEPTEQQKDLSPS-------PPDELLQQLTQL-------KLKPIAEEEPAAADETKVVETPPP 117
              .:..|.:.:|.|.       |.||.|.:....       .|.||::.:...:.:....|....
  Rat    50 QELKEKETETELGPQLSDPDKPPKDEALPRRNDFISVPSIQPLDPISDSDSENSFQDSKPENQKD 114

  Fly   118 MEEPQVDDEVEEEICEEIVDLSEV--PQQPVVQ---------------EATPIEDEDDFSGVDEA 165
            :|:.: |:||...|.|:|::.:::  .|:||..               |..|:||.|....:.|.
  Rat   115 LEDEE-DEEVRRYIMEKIIEANKLLQTQEPVNDKRERKLKFKDKLVDLEVPPLEDSDTCKVLLEN 178

  Fly   166 DLDDDPPAKDSSVPGSLQLRQGTFDQDDSDQKSLTNLLTESDCEEEERTLNEARQKLRDAYKNLY 230
            :.:.........:.|            |..|:|:...:|...|||.:|.:...|           
  Rat   179 ETNMSGKLSQLCISG------------DLGQESMLMSVTNGGCEENDRKILVER----------- 220

  Fly   231 KTLDPKQQETIDRLTGAETEVPLPAPAPVVAAVEAEEEDDLSIIVASYIPDDFELNEQSIY---Y 292
               |.|.:  :..|...|::..||   |:.:|...|.|       :|.:|    |...::.   .
  Rat   221 ---DGKFE--LMNLQDIESQGFLP---PISSANGMEHE-------SSQLP----LRSANLSVGGI 266

  Fly   293 KKEEPDEVRDSCTTCPKATSKTFFTSRSFSFRRRPKPTPTLSSASASTTSPSVRMNYKICCEHRH 357
            ||||| |.:....|..:|..         ...:.|:|.....:..:|..:|.:....: ...||.
  Rat   267 KKEEP-EAKIHIMTLSQAGE---------PLAQVPQPPANPKNRPSSAANPDLNKKTR-RSSHRI 320

  Fly   358 SIQGKLPRYTGYMSEYGLTAQQLQRRDQQLRRKQRFSMEQTINRNEQELKKMQDNERAFTTWLKN 422
            ...|..|    ..|.|.|:.:|.:.:.|..|:::|...|:...:.|:|.:|.::||..|..||:.
  Rat   321 QSAGVSP----VTSTYCLSPRQKELQKQLERKRERLKREEEQRKLEEENEKKKENEMVFKAWLQK 381

  Fly   423 KMRYPINKTRNMFDAHKRRGSVAAAGSPRQ---HPQAHPHL-----HQEQ-EQRGGRRRRRRD 476
            |....:...|      .:|.......|.||   .||....|     |:|| ::|.....|:::
  Rat   382 KREQVVEMRR------VQRAKQIEDMSSRQVNRDPQQAFRLWLKKKHEEQMKERKTEELRKQE 438



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14320
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.