DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13924 and ccdc181

Sequence 1:NP_001189024.1 Gene:CG13924 FlyBaseID:FBgn0035286 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_012813116.1 Gene:ccdc181 XenbaseID:XB-GENE-972794 Length:471 Species:Xenopus tropicalis

Alignment Length:488 Identity:101/489 (21%)
Similarity:159/489 (33%) Gaps:181/489 (37%)


  Fly     4 QLAEMGEREPE------SDEDCEVYFLKPVNEYNIVDRIKEANKELFALDDEASNGNGKVTKVKF 62
            :|.:..|.|.|      .||:...|         |.::|:||||   .|..|..:.| :..|:||
 Frog    74 ELTDKDETEAEYQDNDTEDEEARRY---------IAEKIEEANK---LLQTEIIDEN-RERKLKF 125

  Fly    63 ALNLEDYEPTEQQKDLSPSPPDELLQQLTQLKLKPIAEEEPAAADETKVVETPPPMEEPQVDDEV 127
            ..||.|.|                                            .||:|..::.||.
 Frog   126 KDNLVDLE--------------------------------------------VPPVEYHEMKDER 146

  Fly   128 EEEICEEIVD-LSEVPQQPVVQEATPIEDEDDFSGVDEADLDDDPPAKDSSVPGSLQLRQGTFDQ 191
            .|...||||| ||::.    :..||...:..|..|..|..       ||..:   |..:.|.|: 
 Frog   147 NESADEEIVDGLSQLH----LSNATGTNEHRDDKGSTEEQ-------KDGKI---LIEKDGKFE- 196

  Fly   192 DDSDQKSLTNLLTESDCEEEE--RTLNEARQKLRDAYKNLYKTLDP----KQQETIDRLTGAETE 250
                      |:|.||.|.:.  ..:|.:..: :|..|::.....|    |:.....:......:
 Frog   197 ----------LVTLSDIESQSFLPPINNSSGE-KDMQKSILNAQQPSAFGKEASVGQKGINGYND 250

  Fly   251 VPLPAPAPVVAAVEAEEEDDLSIIVASYIPDDFELNEQSIYYKKEEPDEVRDSCTTCPKATSKTF 315
            |.||.|...                                                        
 Frog   251 VYLPQPPST-------------------------------------------------------- 259

  Fly   316 FTSRSFSFRRRPKPTPTLSSASASTTSPSVRMNYKICCEHRHSIQGKLPRYTGYMSEYGLTAQQ- 379
                       ||..|   |::|.....|.|||    ...|....|...|.|.:.    |:.|| 
 Frog   260 -----------PKVRP---SSAAHLMKSSHRMN----SPRRVQSAGLPSRNTTFC----LSPQQK 302

  Fly   380 -LQRRDQQLRRKQRFSMEQTINRNEQELKKMQDNERAFTTWLKNKMRYPINKTRNMFDAHKRRGS 443
             ||:|.|:.:.|.:...||  .:.|:|.:|..:||.||..|::.| :....:.|.::.|.:..| 
 Frog   303 ELQKRIQERQMKHKKEEEQ--QKKEEEEQKRIENEIAFKAWMQRK-KDQFAEERRIYQAKQLEG- 363

  Fly   444 VAAAGSPRQHPQAHPHLHQEQEQRGGRRRRRRD 476
             .:....::.||...:|..:::.:...|.:|.|
 Frog   364 -MSITEEKRDPQKAFNLWLKRKHKEKLREQRFD 395

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13924NP_001189024.1 None
ccdc181XP_012813116.1 MDN1 <4..182 CDD:227596 41/169 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.