DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rap1 and RSR1

Sequence 1:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_011668.3 Gene:RSR1 SGDID:S000003384 Length:272 Species:Saccharomyces cerevisiae

Alignment Length:180 Identity:100/181 (55%)
Similarity:136/181 (75%) Gaps:1/181 (1%)


  Fly     1 MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65
            ||:||:||||:||||||.|||||||.::::.|||||||||||.:|:|.:...||||||||..|||
Yeast     1 MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSYRKTIEIDNKVFDLEILDTAGIAQFT 65

  Fly    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKEL 130
            |||:||:|:|.||:||||:|.:.:..:|.:||||:||:||:|.|||||:|||.||..|||:..|.
Yeast    66 AMRELYIKSGMGFLLVYSVTDRQSLEELMELREQVLRIKDSDRVPMVLIGNKADLINERVISVEE 130

  Fly   131 GKNLATQF-NCAFMETSAKAKVNVNDIFYDLVRQINKKSPEKKQKKPKKS 179
            |..::::: ...|.||||..:.||:::|.||||||.:...|....|..::
Yeast   131 GIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQIIRNEMESVAVKDARN 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 96/163 (59%)
RSR1NP_011668.3 RSR1 3..166 CDD:133377 96/163 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S256
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000044
OrthoInspector 1 1.000 T1135668
orthoMCL 1 0.900 OOG5_129336
Panther 1 1.100 LDO PTHR24070
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1068
TreeFam 00.000 Not matched by this tool.
76.980

Return to query results.
Submit another query.