DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rap1 and RABB1a

Sequence 1:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_193449.1 Gene:RABB1a AraportID:AT4G17160 Length:205 Species:Arabidopsis thaliana

Alignment Length:165 Identity:60/166 (36%)
Similarity:91/166 (55%) Gaps:2/166 (1%)


  Fly     4 YKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSY-RKQVEVDGQQCMLEILDTAGTEQFTAM 67
            :|.:::|..|||||.|.::|....|...:|.||...: .|.:.:|.:...|:|.||||.|.|.::
plant     7 FKYIIIGDTGVGKSCLLLKFTDKRFQAVHDLTIGVEFGAKTITIDNKPIKLQIWDTAGQESFRSV 71

  Fly    68 RDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELGK 132
            ...|.:...|.:|||.||.:.|||.|....|: .|...::::..:|:|||||||::|.|..|.|:
plant    72 TRSYYRGRAGTLLVYDITRRETFNHLASWLEE-ARQHASENMTTMLIGNKCDLEDKRTVSTEEGE 135

  Fly   133 NLATQFNCAFMETSAKAKVNVNDIFYDLVRQINKK 167
            ..|.:....|||.|||...||.:.|.:....|.|:
plant   136 QFAREHGLIFMEASAKTAHNVEEAFVETAATIYKR 170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 59/162 (36%)
RABB1aNP_193449.1 PLN03108 1..204 CDD:178655 60/166 (36%)
Rab2 3..170 CDD:206658 60/164 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
10.910

Return to query results.
Submit another query.