DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rap1 and Rras2

Sequence 1:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_080122.2 Gene:Rras2 MGIID:1914172 Length:204 Species:Mus musculus

Alignment Length:190 Identity:96/191 (50%)
Similarity:133/191 (70%) Gaps:9/191 (5%)


  Fly     3 EYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAM 67
            :|::||:|.|||||||||:||:|..||..|||||||||.||..:|.:...|:||||||.|:|.||
Mouse    14 KYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAM 78

  Fly    68 RDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELGK 132
            |:.||:.|:||:||:|:|.:.:|.::...:.|||||||.|:.||:|:|||.||:.:|.|.:|.|:
Mouse    79 REQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQ 143

  Fly   133 NLATQFNCAFMETSAKAKVNVNDIFYDLVRQINK-------KSPE--KKQKKPKKSLCVL 183
            .||.|....:||.|||.::||:..|::|||.|.|       .|||  :|:|..|...||:
Mouse   144 QLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVI 203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 87/162 (54%)
Rras2NP_080122.2 M_R_Ras_like 13..176 CDD:133345 87/162 (54%)
Effector region 43..51 8/8 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000044
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1068
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.