DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rap1 and rap1aa

Sequence 1:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001002152.1 Gene:rap1aa ZFINID:ZDB-GENE-040625-167 Length:185 Species:Danio rerio

Alignment Length:185 Identity:161/186 (87%)
Similarity:176/186 (95%) Gaps:1/186 (1%)


  Fly     1 MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65
            |||||:|||||||||||||||||||.|||||||||||||||||||||||||||||||||||||||
Zfish     1 MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65

  Fly    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKEL 130
            |||||||||||||.|||||||||||||||||||||||||||:||||:|||||||||||||||||.
Zfish    66 AMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEEERVVGKEQ 130

  Fly   131 GKNLATQF-NCAFMETSAKAKVNVNDIFYDLVRQINKKSPEKKQKKPKKSLCVLL 184
            |:|||.|: ||||:|:|||:|:|||:||||||||||:|:|.:|::..|||.||||
Zfish   131 GQNLARQWSNCAFLESSAKSKINVNEIFYDLVRQINRKTPVEKKRAKKKSNCVLL 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 148/163 (91%)
rap1aaNP_001002152.1 small_GTPase 2..168 CDD:197466 150/166 (90%)
Rap1 3..167 CDD:133375 149/164 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BE8V
Hieranoid 1 1.000
Homologene 1 1.000 H2162
Inparanoid 1 1.050 322 1.000 Inparanoid score I2441
OMA 1 1.010
OrthoDB 1 1.010 D1353024at2759
OrthoFinder 1 1.000 FOG0000044
OrthoInspector 1 1.000 T596306
orthoMCL 1 0.900 OOG5_129336
Panther 1 1.100 O PTHR24070
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1068
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.