DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap1 and CG8500

DIOPT Version :9

Sequence 1:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001303452.1 Gene:CG8500 / 41203 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster


Alignment Length:189 Identity:78/189 - (41%)
Similarity:120/189 - (63%) Gaps:13/189 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAM 67
            :|::||.|:||||||:|.::|::..|.|.|.|||||:||:.:..:...|.|:|.||.|:.||.||
  Fly    18 DYRVVVFGAGGVGKSSLVLRFIKGTFRESYIPTIEDTYRQVISCNKNICTLQITDTTGSHQFPAM 82

  Fly    68 RDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTD--DVPMVLVGNKCD-LEEERVVGKE 129
            :.|.:..|..|:||||:.::.:..:|:.:...|..:|..|  ::|::||||||| ..|.|.|.:.
  Fly    83 QRLSISKGHAFILVYSVCSKQSLEELRPIWALIKELKGADIPNIPVMLVGNKCDETAELREVSQA 147

  Fly   130 LGKNLATQFNCAFMETSAKAKVNVNDIFYDLVR---------QINKKSPEKKQKKPKKS 179
            .|:..||.::.:|||||||...||.::|.:|:.         |::.|. :|||||.|||
  Fly   148 EGQAQATTWSISFMETSAKTNHNVTELFQELLNMEKTRTVSLQLDTKK-QKKQKKEKKS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 69/173 (40%)
CG8500NP_001303452.1 ARHI_like 18..183 CDD:206711 68/164 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453011
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.