DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rap1 and rap1ab

Sequence 1:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001230108.1 Gene:rap1ab ZFINID:ZDB-GENE-040426-2738 Length:185 Species:Danio rerio

Alignment Length:185 Identity:161/186 (87%)
Similarity:175/186 (94%) Gaps:1/186 (1%)


  Fly     1 MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65
            |||||:|||||||||||||||||||.|||||||||||||||||||||||||||||||||||||||
Zfish     1 MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65

  Fly    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKEL 130
            |||||||||||||.|||||||||||||||||||||||||||:||||:|||||||||:|||||||.
Zfish    66 AMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVVGKEQ 130

  Fly   131 GKNLATQF-NCAFMETSAKAKVNVNDIFYDLVRQINKKSPEKKQKKPKKSLCVLL 184
            |:|||.|: ||||:|:|||:|:||.|||||||||||:|:|.:|:|..|||.||||
Zfish   131 GQNLARQWNNCAFLESSAKSKINVLDIFYDLVRQINRKTPVEKKKAKKKSNCVLL 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 147/163 (90%)
rap1abNP_001230108.1 Rap1 3..167 CDD:133375 148/164 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BE8V
Hieranoid 1 1.000
Homologene 1 1.000 H2162
Inparanoid 1 1.050 322 1.000 Inparanoid score I2441
OMA 1 1.010
OrthoDB 1 1.010 D1353024at2759
OrthoFinder 1 1.000 FOG0000044
OrthoInspector 1 1.000 T596306
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24070
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1068
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.970

Return to query results.
Submit another query.