DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rap1 and CG8641

Sequence 1:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001261494.1 Gene:CG8641 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster

Alignment Length:171 Identity:62/172 (36%)
Similarity:96/172 (56%) Gaps:14/172 (8%)


  Fly     4 YKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMR 68
            |::|:|||...|||::..:|:...|.|.|.||||:.:||...:..:...|:||||:|...|.|||
  Fly   167 YRLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDTSGYHPFPAMR 231

  Fly    69 DLYMKNGQGFVLVYSITAQSTFNDLQDLREQIL-------------RVKDTDDVPMVLVGNKCDL 120
            .|....|..|:||:|:.::.:|.::..|||.||             :.|....:||:|.|||||.
  Fly   232 RLSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMILAGNKCDR 296

  Fly   121 EEERVVGKELGKNLATQFN-CAFMETSAKAKVNVNDIFYDL 160
            :.:.|...|:...:|.|.| |.|:|.||:....::|:|:.|
  Fly   297 DFKTVQVDEVMGYIAGQDNCCTFVECSARQNYRIDDLFHSL 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 62/172 (36%)
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 62/172 (36%)
RAS 167..338 CDD:214541 62/172 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120121064
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.