DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rap1 and Ras64B

Sequence 1:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_523917.2 Gene:Ras64B FlyBaseID:FBgn0003206 Length:192 Species:Drosophila melanogaster

Alignment Length:190 Identity:91/191 (48%)
Similarity:132/191 (69%) Gaps:6/191 (3%)


  Fly     1 MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65
            |:.||:||:|.|||||||:|:||:|..||..|||||||||.||..:|.....|:||||||.|:|:
  Fly     3 MQTYKLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFS 67

  Fly    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKEL 130
            |||:.||::|:||:||:::...|:|:::...:.|||||||.|:.||::|||||||:.::.|..|.
  Fly    68 AMREQYMRSGEGFLLVFALNDHSSFDEIPKFQRQILRVKDRDEFPMLMVGNKCDLKHQQQVSLEE 132

  Fly   131 GKNLATQFNCAFMETSAKAKVNVNDIFYDLVRQINK----KSP--EKKQKKPKKSLCVLL 184
            .:|.:......::|.|||.:|||:..|::|||.:.|    :.|  |:..||..|..|.|:
  Fly   133 AQNTSRNLMIPYIECSAKLRVNVDQAFHELVRIVRKFQIAERPFIEQDYKKKGKRKCCLM 192

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 82/162 (51%)
Ras64BNP_523917.2 M_R_Ras_like 4..167 CDD:133345 82/163 (50%)
RAS 18..169 CDD:214541 74/151 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120121111
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000044
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24070
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1068
44.060

Return to query results.
Submit another query.