DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rap1 and Rras

Sequence 1:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001101951.1 Gene:Rras RGDID:1311443 Length:218 Species:Rattus norvegicus

Alignment Length:189 Identity:92/190 (48%)
Similarity:122/190 (64%) Gaps:8/190 (4%)


  Fly     4 YKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMR 68
            :|:||:|.|||||||||:||:|..||..|||||||||.|...|||....|:||||||.|:|.|||
  Rat    30 HKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGIPARLDILDTAGQEEFGAMR 94

  Fly    69 DLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELGKN 133
            :.||:.|.||:||::|..:.:|.::..|..|||||||.||.|:||||||.|||.:|.|.:....:
  Rat    95 EQYMRAGNGFLLVFAINDRQSFIEVSKLFTQILRVKDRDDFPIVLVGNKADLETQRQVLRSEASS 159

  Fly   134 LATQFNCAFMETSAKAKVNVNDIFYDLVRQINK--------KSPEKKQKKPKKSLCVLL 184
            .:...:..:.|.|||.::||::.|..|||.:.|        ..|...:||..:..||||
  Rat   160 FSASHHMTYFEASAKLRLNVDEAFEQLVRTVRKYQEQELPPSPPSAPRKKDGRCPCVLL 218

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 84/161 (52%)
RrasNP_001101951.1 P-loop_NTPase 28..191 CDD:304359 84/161 (52%)
small_GTPase 42..193 CDD:197466 77/151 (51%)
Effector region 58..66 8/8 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000044
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.