DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rap1 and rap1b

Sequence 1:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_955827.1 Gene:rap1b ZFINID:ZDB-GENE-030131-9662 Length:184 Species:Danio rerio

Alignment Length:185 Identity:159/186 (85%)
Similarity:171/186 (92%) Gaps:2/186 (1%)


  Fly     1 MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65
            |||||:|||||||||||||||||||.|||||||||||||||||||||||||||||||||||||||
Zfish     1 MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFT 65

  Fly    66 AMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKEL 130
            |||||||||||||.|||||||||||||||||||||||||.||||||:|||||||||:|||||||.
Zfish    66 AMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKGTDDVPMILVGNKCDLEDERVVGKEQ 130

  Fly   131 GKNLATQFN-CAFMETSAKAKVNVNDIFYDLVRQINKKSPEKKQKKPKKSLCVLL 184
            |:|||.|:| |||:|:|||:|:|||:||||||||||:|:| ...|..|||.|.||
Zfish   131 GQNLARQWNSCAFLESSAKSKINVNEIFYDLVRQINRKTP-VTGKPRKKSTCQLL 184

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 147/163 (90%)
rap1bNP_955827.1 small_GTPase 2..168 CDD:197466 149/166 (90%)
Rap1 3..167 CDD:133375 148/164 (90%)
Effector region. {ECO:0000305} 32..40 8/8 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 322 1.000 Inparanoid score I2441
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1353024at2759
OrthoFinder 1 1.000 FOG0000044
OrthoInspector 1 1.000 T596306
orthoMCL 1 0.900 OOG5_129336
Panther 1 1.100 O PTHR24070
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1068
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.