DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rap1 and Rala

Sequence 1:NP_001189023.1 Gene:Rap1 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_525063.1 Gene:Rala FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster

Alignment Length:190 Identity:87/191 (46%)
Similarity:130/191 (68%) Gaps:9/191 (5%)


  Fly     4 YKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMR 68
            :|::::|||||||||||:||:...|||.|:||..|||||:|.:||::..::||||||.|.:.|:|
  Fly    12 HKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIR 76

  Fly    69 DLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELGKN 133
            |.|.::|:||:.|:|||...:|...|:.||||||||:.:.:|.:||||||||.::|.|.....:.
  Fly    77 DNYFRSGEGFLCVFSITDDESFQATQEFREQILRVKNDESIPFLLVGNKCDLNDKRKVPLSECQL 141

  Fly   134 LATQFNCAFMETSAKAKVNVNDIFYDLVRQINKKSPE---------KKQKKPKKSLCVLL 184
            .|.|:...::|||||.:.||:.:|:||:|:|..:..|         |.:.|.::..|.||
  Fly   142 RAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTEDSKATSGRAKDRCKKRRLKCTLL 201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 81/161 (50%)
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 81/162 (50%)
small_GTPase 12..173 CDD:197466 81/161 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120121018
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24070
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.